Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR626 IGR629 IGR628 IGR627 rsbU, - CPn0793 CPn0791 CPn0794 CPn0795 CPn0796 rsbU, - CPn0793 CPn0791 CPn0794 CPn0795 CPn0796 rsbU, - CPn0793 CPn0791 CPn0792 CPn0792 CPn0794 CPn0795 CPn0796
* Calculated from Protein Sequence

Gene ID: CPn0793

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rsbU  

Definition:
sigma regulatory family protein - PP2C phosphatase (RsbW antagonist)

Gene Start:
896823

Gene Stop:
894916

Gene Length:
1908

Molecular Weight*:
70785

pI*:
6.70

Net Charge*:
-2.40

EC:
 

Functional Class:
regulatory functions  

Pathway: pathway table

Comment:
RsbU is a sigma regulatory family protein-PP2C phosphatase. RsbU is an IcfG/RsbU family sigma regulator; may share a conserved domain with sensory transduction histidine kinases (ref. http://chlamydia-www.berkeley.edu:4231/cpn/rsbU.html).

Blast Summary:  PSI-Blast Search
CPn0793 orthologously related to CT588: residues 1-632 of CPn0793 are 57% similar to residues 12-643 of CT588, a probable sensory transduction regulatory component.

COGS Summary:  COGS Search
BeTs to 6 clades of COG2208
COG name: Serine phosphatase RsbU, regulator of sigma subunit
Functional Class:  T,K
The phylogenetic pattern of COG2208 is ------vC-Br------Lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 305 to 374 (E-value = 4.8e-08) place CPn0793 in the HAMP family which is described as HAMP domain (PF00672)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
14  
31
transmembrane  
307  
324

PDB Hit:


Gene Protein Sequence:
MIPFTKTIGFRLWLACAVAIIAPLGINIVWLNLDQYRTIVSAISTALKEN
AAFKANTLTQIVPLNVDVLSLFSDVLDLDAGIPETPNVLLSNEMQKVFQG
IYNEISLIKVFPNGDKIVVASSIPEHLGENYNHKIDIPKNTPFLAALKQS
PKNQEVFSVMQANVFDAKTQELQGILYTTFSAESLLKDLLINKQSYLTVK
TAILSKYGVILKASDPALHLHTVYPDMTKEKFCQVFLNDDPCPIDSELGP
LTLSPLDIGENFYSFKIKDTEIWGCIENVPSIDIAVLSYAKKEESFAPLW
RRARMYTAYFFCILLGSLIAFIVARRLSLPIRKLATAMIESRKNKNCLYT
DDSLGFEINRLGHIFNAMVENLHKQQHLAKTNFEMKENAQNALHLGEQAQ
QRLLPNTLPSYPHIELAKAYIPAITVGGDFFDVFVVGEGSKARLFLIVAD
ASGKGVNACGYSLFLKNMLRTFLSRSSSLQQAIQETSRLFYNNTKNSGMF
VTLCVYCYHQTSNTMEYYSCGHPPACYLDPDGETSWLFHPGMALGFLPEV
ANITSKLFHPKPGSLFVLYSDGITEAHNNNNDMFGEERLQAAIQGLTGKS
AADAVHRLMLSVKTFVGNSHQHDDITLLILKVLES$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCCCTTTTACTAAAACAATAGGGTTCCGTTTGTGGTTGGCTTGCGC
CGTTGCTATCATTGCACCTCTAGGGATCAACATCGTATGGTTAAACCTAG
ATCAATACCGCACCATAGTCTCTGCTATTTCTACTGCACTGAAAGAAAAC
GCTGCTTTCAAAGCCAATACTCTCACTCAGATTGTCCCTTTGAATGTCGA
TGTTCTATCTCTATTTTCTGATGTCTTAGATTTAGATGCTGGTATTCCAG
AGACTCCGAACGTTCTCCTTAGCAATGAAATGCAGAAAGTATTCCAAGGG
ATCTATAATGAAATCTCTTTAATCAAGGTATTCCCAAATGGAGATAAAAT
TGTTGTTGCTTCTAGCATTCCTGAACACTTAGGGGAAAACTATAATCACA
AAATAGACATCCCTAAGAACACTCCATTTTTAGCAGCCCTAAAACAATCT
CCTAAAAATCAGGAAGTCTTTTCTGTAATGCAAGCTAATGTTTTTGATGC
AAAAACTCAAGAACTCCAAGGGATCTTATACACCACGTTCAGTGCTGAGA
GCTTACTCAAAGATCTCCTGATAAACAAGCAATCCTATCTCACTGTAAAA
ACTGCGATCCTTTCCAAATACGGCGTTATCTTAAAAGCTTCTGATCCTGC
TCTCCATCTCCATACTGTCTACCCTGACATGACGAAAGAAAAATTCTGCC
AAGTTTTTCTCAATGATGATCCTTGCCCTATAGACTCAGAATTAGGTCCT
TTAACTCTCTCCCCTCTGGATATTGGAGAAAATTTCTATTCTTTTAAAAT
CAAAGATACTGAGATTTGGGGCTGTATTGAAAATGTTCCCAGTATAGATA
TTGCAGTCCTTTCCTATGCTAAAAAAGAAGAGAGCTTTGCGCCTTTATGG
CGCAGAGCTCGCATGTACACTGCCTATTTCTTTTGCATTCTCTTAGGGAG
CCTCATAGCCTTTATTGTAGCAAGACGATTGTCGTTACCTATCAGAAAAC
TTGCCACTGCGATGATAGAATCTAGGAAAAACAAAAACTGCCTCTATACT
GACGACTCCTTAGGGTTTGAGATCAACAGACTTGGCCATATTTTTAATGC
TATGGTGGAGAATCTCCACAAACAGCAACACCTCGCTAAGACGAACTTTG
AGATGAAAGAAAATGCACAGAACGCTCTACATTTAGGAGAGCAGGCTCAG
CAGCGACTTCTTCCTAATACTCTCCCCAGCTATCCTCATATAGAACTCGC
AAAAGCCTATATCCCTGCCATTACTGTAGGTGGTGATTTCTTTGATGTTT
TTGTTGTAGGAGAGGGTTCGAAGGCTCGCCTATTCCTGATTGTTGCTGAC
GCCTCAGGGAAAGGTGTTAATGCTTGTGGGTATTCGCTATTTCTAAAAAA
TATGCTCAGAACATTCCTTTCTCGCTCTTCGTCTCTTCAACAGGCAATCC
AAGAAACCTCACGCTTATTTTATAACAATACAAAAAACTCAGGGATGTTT
GTCACTCTATGTGTGTACTGTTATCATCAAACTTCCAACACCATGGAATA
TTATTCTTGTGGACATCCTCCTGCCTGCTACCTAGATCCTGATGGCGAGA
CTTCTTGGCTATTCCATCCTGGAATGGCTTTAGGCTTCCTTCCCGAAGTT
GCGAACATCACTTCAAAGCTATTTCATCCTAAGCCAGGGTCTCTCTTTGT
CTTGTATTCTGATGGTATTACAGAAGCCCATAATAACAATAACGACATGT
TTGGAGAAGAGCGCCTACAAGCTGCAATTCAAGGATTGACAGGGAAAAGT
GCTGCTGATGCCGTCCACAGGTTGATGTTAAGTGTAAAAACCTTTGTCGG
GAACTCCCATCAACATGACGACATCACCTTATTAATATTAAAGGTATTAG
AATCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy