Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR625 IGR624 IGR626 IGR628 IGR627 rsbU, - CPn0793 CPn0791 sdhB, - CPn0790 CPn0794 CPn0795 sdhA, - CPn0789 rsbU, - CPn0793 CPn0791 sdhB, - CPn0790 CPn0794 CPn0795 sdhA, - CPn0789 rsbU, - CPn0793 CPn0791 CPn0792 CPn0792 sdhB, - CPn0790 CPn0794 CPn0795 sdhA, - CPn0789
* Calculated from Protein Sequence

Gene ID: CPn0792

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
894919

Gene Stop:
893105

Gene Length:
1815

Molecular Weight*:
67510

pI*:
6.60

Net Charge*:
-2.41

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0793 is orthologously related to CT589: residues 1-603 of CPn0792 are 47% similar to residues 1-601 of CT589, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.
CPn0793 is also similar to CT588, a probable sensory transduction regulatory component from C. trachomatis.
No significant similarity to T. pallidum, M. genitalium, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
CPn0793 is a possible paralog. Residues 135-511 are 21% similar to CPn0793.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
15  
33
transmembrane  
296  
313
transmembrane  
445  
462

PDB Hit:


Gene Protein Sequence:
MKHTFTKRVLFFFFLVIPIPLLLNLMVVGFFSFSAAKANLVQVLHTRATN
LSIEFEKKLTIHKLFLDRLANTLALKSYASPSAEPYAQAYNEMMALSNTD
FSLCLIDPFDGSVRTKNPGDPFIRYLKQHPEMKKKLSAAVGKAFLLTIPG
KPLLHYLILVEDVASWDSTTTSGLLVSFYPMSFLQKDLFQSLHITKGNIC
LVNKYGEVLFCAQDSESSFVFSLDLPNLPQFQARSPSAIEIEKASGILGG
ENLITVSINKKRYLGLVLNKIPIQGTYTLSLVPVSDLIQSALKVPLNICF
FYVLAFLLMWWIFSKINTKLNKPLQELTFCMEAAWRGNHNVRFEPQPYGY
EFNELGNIFNCTLLLLLNSIEKADIDYHSGEKLQKELGILSSLQSALLSP
DFPTFPKVTFSSQHLRRRQLSGHFNGWTVQDGGDTLLGIIGLAGDIGLPS
YLYALSARSLFLAYASSDVSLQKISKDTADSFSKTTEGNEAVVAMTFIKY
VEKDRSLELLSLSEGAPTMFLQRGESFVRLPLETHQALQPGDRLICLTGG
EDILKYFSQLPIEELLKDPLNPLNTENLIDSLTMMLNNETEHSADGTLTI
LSFS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACATACCTTTACCAAGCGTGTTCTATTTTTTTTCTTTTTAGTGAT
TCCCATTCCCCTACTCCTCAATCTTATGGTCGTAGGTTTTTTCTCATTTT
CTGCCGCTAAAGCAAATTTAGTACAGGTCCTCCATACCCGTGCTACGAAC
TTAAGTATAGAATTCGAAAAAAAACTGACGATACACAAGCTTTTCCTCGA
TAGACTTGCCAACACATTAGCCTTAAAATCCTATGCATCTCCTTCTGCAG
AGCCCTATGCACAGGCATACAATGAGATGATGGCACTCTCCAATACAGAC
TTTTCCTTATGCCTTATAGATCCCTTTGATGGATCTGTAAGGACGAAAAA
TCCTGGAGACCCTTTCATTCGCTATCTAAAACAGCATCCTGAAATGAAGA
AAAAGCTATCCGCAGCTGTAGGGAAAGCCTTTTTATTGACCATTCCAGGT
AAACCACTTTTACATTATCTTATTCTAGTTGAAGATGTCGCATCTTGGGA
TTCTACAACGACTTCAGGACTGCTTGTAAGTTTCTATCCCATGTCTTTTT
TACAGAAAGATTTATTCCAATCCTTACACATCACCAAAGGAAATATCTGC
CTTGTAAATAAGTATGGCGAGGTCCTCTTCTGTGCTCAGGACAGTGAATC
TTCTTTTGTATTTTCTCTAGATCTCCCTAATTTACCGCAATTCCAAGCAA
GAAGCCCCTCTGCCATAGAAATTGAGAAAGCTTCTGGAATTCTTGGTGGG
GAGAACCTAATCACAGTGAGTATCAACAAGAAACGCTACCTAGGATTGGT
ACTGAATAAAATTCCTATCCAAGGGACCTACACTCTATCTTTAGTTCCAG
TTTCTGATCTCATCCAATCCGCCTTGAAAGTTCCTCTCAATATTTGTTTT
TTCTATGTACTTGCTTTCCTCCTCATGTGGTGGATTTTCTCTAAGATCAA
CACCAAACTTAACAAGCCTCTTCAAGAACTGACCTTCTGTATGGAAGCTG
CCTGGCGAGGAAACCATAACGTGAGGTTTGAACCCCAGCCTTACGGTTAT
GAATTCAATGAACTAGGAAATATTTTCAATTGCACTCTCCTACTCTTATT
GAATTCCATTGAGAAAGCAGATATCGATTACCATTCAGGCGAAAAATTAC
AAAAAGAATTAGGGATTTTATCTTCACTACAAAGTGCGTTACTAAGTCCG
GATTTCCCTACGTTCCCTAAAGTTACCTTTAGTTCCCAACATCTCCGGAG
AAGGCAACTTTCCGGTCATTTTAATGGTTGGACAGTTCAAGATGGTGGCG
ATACCCTTTTAGGGATCATAGGGCTCGCTGGCGATATTGGTCTTCCTTCC
TATCTCTATGCTTTATCCGCACGGAGTCTTTTTCTTGCCTATGCTTCCTC
GGACGTTTCGTTACAAAAAATCAGCAAGGATACTGCCGACAGCTTCTCAA
AAACAACAGAAGGCAATGAGGCTGTAGTTGCTATGACTTTCATTAAATAT
GTAGAAAAAGATCGATCTCTAGAGCTCCTCTCGTTAAGCGAGGGAGCTCC
TACCATGTTTCTACAACGAGGAGAATCTTTCGTACGTCTCCCCTTAGAGA
CTCACCAAGCTCTACAGCCTGGAGATCGGTTGATCTGCCTCACTGGAGGA
GAAGACATCCTCAAGTACTTTTCTCAGCTTCCTATTGAAGAGCTCTTAAA
AGATCCTTTAAACCCTCTAAATACAGAGAATCTTATTGATTCTCTAACCA
TGATGTTAAACAACGAAACCGAACATTCTGCAGATGGAACTCTGACCATC
CTTTCATTTTCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy