Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR625 IGR623 IGR624 IGR626 rsbU, - CPn0793 CPn0791 sdhB, - CPn0790 sdhC, - CPn0788 sdhA, - CPn0789 rsbU, - CPn0793 CPn0791 sdhB, - CPn0790 sdhC, - CPn0788 sdhA, - CPn0789 rsbU, - CPn0793 CPn0791 CPn0792 CPn0792 sdhB, - CPn0790 sdhC, - CPn0788 sdhA, - CPn0789
* Calculated from Protein Sequence

Gene ID: CPn0791

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
893050

Gene Stop:
890108

Gene Length:
2943

Molecular Weight*:
113097

pI*:
6.40

Net Charge*:
-14.18

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT590, a hypothetical protein sequence. Residues 18-980 are 57% similar to CT590.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
266  
303

PDB Hit:


Gene Protein Sequence:
MYSCYSKGISHNYLLHPMSRLDIFVFDSLIANQDQNLLEEIFCSEDTVLF
KAYRTTALQSPLAAKNLNIARKVANYILADNGEIDTVKLVEAIHHLSQCT
YPLGPHRHNEAQDREHLLKMLKALKENPKLKESIKTLFVPSYSTIQNLIR
HTLALNPQTILSTIHVRQAALTALFTYLRQDVGSCFATAPAILIHQEYPE
RFLKDLNDLISSGKLSRIVNQREIAVPINLSGCIGELFKPLRILDLYPDP
LVKLSSSPGLKKAFSAANLIETLGDSEAQIQQLLSHQYLMQKLQNVHETL
TANDIIKSTLLHYYQLQESTVRAIFFKEGLFSKEQVAFSTQHPRELSEIQ
RVYHYLHAYEEAKSAFIHDTQNPLLKAWEYTLATLADASQPTISNHIRLA
LGWKSEDPHSLVSLVTHFVEEEVENIRILVQQCEQTYHEARSQLEYIEGR
MRNPLNNQDSQILTMDHMRFRQELNKALYEWDSAQEKAKKFLHLPEFLLS
FYTKQIPLYFRSSYDAFIQEFAHLYANAPAGFRILFTHGRTHPNTWSPIY
SINEFIRFLSEFFTSTESELLGKHAVINLEKETSRLVHNITAMLHTDVFQ
EALLTRILEAYQLPVPPSILNHLDQLSQTPWVYVSGGTVDTLLLDYFESS
EPLTLTEKHPENPHELAAFYADALKDLPTGIKSYLEEGSHSLLSSSPTHV
FSIIAGSPLFREAWDNDWYSYTWLRDVWVKQHQDFLQDTILPQLSIYAFI
ENFCNKYALQHVVHDFHDFCSDHSLTLPELYDKGSRFLSSLFTKDKTVAL
IYIRRLLYLMVREVPYVSEQQLPEVLDNVSSYLGISSRITYEKFRSLIEE
TIPKMTLLSSADLRHIYKGLLMQSYQKIYTEEDTYLRLTTAMRHHNLAYP
APLLFADSNWPSIYFGFILNPGTTEIDLWKFNYAGLQGQPLDNIQELFAT
SRPWTLYANPIDYGMPPPPGYRSRLPKEFF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATTCGTGTTACAGCAAAGGAATATCCCATAACTATCTTCTACATCC
TATGTCACGTTTGGATATTTTTGTTTTCGATTCTCTGATCGCAAACCAGG
ATCAAAATCTTCTTGAGGAAATTTTCTGTTCTGAAGACACAGTTTTATTT
AAAGCCTACCGTACTACGGCTCTACAATCCCCTCTAGCTGCTAAGAACCT
AAATATCGCCCGTAAAGTCGCAAATTATATCTTAGCTGACAATGGGGAAA
TCGATACAGTAAAGCTTGTCGAAGCCATTCACCATCTCTCACAATGTACC
TATCCTTTAGGGCCTCATCGCCATAATGAAGCTCAAGATCGTGAACACCT
CCTTAAAATGCTAAAAGCTCTAAAGGAAAATCCTAAATTAAAAGAAAGCA
TCAAAACTCTCTTTGTCCCTTCATACTCTACAATCCAAAACCTAATTCGC
CATACACTAGCATTGAATCCACAGACAATTCTCTCTACGATTCATGTGCG
TCAAGCAGCACTCACAGCGCTCTTCACCTACCTTCGGCAAGATGTAGGTT
CCTGTTTTGCTACGGCTCCTGCCATTCTCATTCACCAAGAATATCCAGAA
CGATTCCTTAAAGATCTCAATGATCTCATTAGCAGTGGCAAACTCTCTAG
AATCGTAAACCAAAGGGAAATTGCGGTTCCTATAAACCTTTCGGGATGCA
TTGGAGAGCTATTCAAGCCTTTAAGGATTCTAGATCTTTATCCTGATCCT
CTGGTTAAGCTCTCCTCATCTCCAGGACTCAAAAAAGCCTTTTCTGCTGC
CAATCTTATTGAAACTCTTGGGGATTCTGAAGCACAAATCCAACAGTTGC
TCTCGCATCAATATTTGATGCAAAAACTACAAAATGTCCATGAGACCTTA
ACTGCTAACGACATTATCAAATCGACACTTCTGCACTACTATCAGCTCCA
AGAAAGTACTGTACGAGCTATTTTCTTCAAAGAAGGGTTGTTCAGCAAAG
AACAAGTGGCATTCTCGACGCAACACCCCAGAGAGCTCTCAGAAATACAA
CGGGTATACCACTACTTACATGCCTATGAAGAAGCAAAATCTGCTTTTAT
CCATGACACTCAAAATCCCTTACTGAAAGCCTGGGAGTATACTTTAGCGA
CTCTTGCGGATGCTAGCCAACCTACCATCTCAAACCATATCCGCCTTGCC
TTAGGATGGAAAAGTGAAGACCCTCACAGTCTTGTATCTCTAGTTACACA
CTTTGTTGAAGAGGAAGTAGAAAACATCCGAATTTTAGTCCAACAATGTG
AACAGACCTATCACGAAGCACGCTCCCAACTAGAATATATTGAAGGGCGG
ATGCGCAACCCACTAAATAATCAAGACAGTCAGATTTTGACGATGGATCA
CATGCGCTTCCGTCAAGAACTCAATAAAGCTCTTTATGAGTGGGATAGTG
CTCAAGAAAAGGCAAAGAAATTTCTACATCTTCCTGAATTCTTACTTTCT
TTCTATACAAAGCAAATTCCCTTATACTTTCGTAGTTCTTACGATGCCTT
CATTCAAGAATTTGCTCATCTCTATGCTAATGCTCCCGCTGGCTTCCGTA
TTCTTTTCACGCATGGACGCACCCATCCGAACACATGGTCCCCCATCTAT
TCGATTAATGAATTTATACGTTTTCTTTCTGAATTCTTCACCTCCACAGA
GTCAGAACTTCTGGGGAAACATGCCGTGATCAATTTAGAGAAAGAAACAT
CTCGGCTCGTCCACAACATCACTGCCATGCTACACACGGATGTTTTCCAA
GAAGCTCTCCTTACAAGAATTTTAGAAGCCTATCAGCTTCCTGTGCCTCC
CTCCATCTTAAACCACTTAGATCAGCTGTCACAAACTCCCTGGGTTTATG
TTTCTGGAGGAACAGTGGACACTCTTCTTTTGGATTATTTTGAAAGCTCA
GAACCTCTGACACTTACAGAAAAGCATCCTGAAAATCCTCATGAGCTTGC
AGCTTTCTACGCAGACGCCCTTAAAGATCTCCCTACAGGAATTAAAAGTT
ATCTAGAAGAAGGATCCCACTCTCTACTTAGCTCATCACCCACCCACGTT
TTCTCTATAATCGCAGGATCTCCTTTATTTCGGGAAGCTTGGGATAATGA
TTGGTACAGCTATACCTGGCTTCGTGATGTCTGGGTGAAACAACACCAAG
ATTTCCTTCAAGATACTATATTACCTCAGCTAAGTATCTATGCTTTCATA
GAGAATTTTTGTAACAAATATGCTTTGCAACATGTAGTTCATGACTTTCA
TGATTTCTGCTCCGACCACTCCTTGACTCTTCCGGAGCTCTATGACAAAG
GATCGCGTTTTCTAAGCTCCTTATTCACCAAAGATAAGACCGTAGCTCTT
ATCTATATACGCCGTCTTCTCTACCTTATGGTCCGTGAAGTCCCTTATGT
TTCAGAACAACAGCTTCCAGAAGTCTTAGATAACGTCTCTTCATATCTCG
GGATTTCCTCTCGTATTACCTATGAGAAATTCCGCTCCCTGATAGAGGAA
ACCATCCCTAAAATGACCTTACTCTCCTCAGCAGACCTGAGGCATATCTA
TAAAGGTCTCCTCATGCAAAGTTATCAAAAGATCTACACCGAAGAAGATA
CGTACCTCCGCCTCACCACGGCAATGAGGCATCATAATCTTGCCTATCCC
GCTCCTTTGCTCTTTGCAGACAGTAACTGGCCTTCTATTTATTTTGGATT
CATCCTAAATCCAGGAACCACAGAGATCGATCTTTGGAAATTTAACTATG
CAGGGCTGCAAGGACAGCCTCTTGACAATATCCAGGAGCTGTTCGCAACG
TCAAGACCCTGGACCCTCTATGCAAATCCTATAGATTATGGCATGCCACC
GCCTCCAGGCTACCGCAGCCGCCTCCCTAAAGAATTTTTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy