Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR625 IGR623 IGR624 IGR626 IGR622 IGR621 CPn0792 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 CPn0792 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 CPn0792 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0790

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sdhB  

Definition:
succinate dehydrogenase iron-sulfur component

Gene Start:
889330

Gene Stop:
890106

Gene Length:
777

Molecular Weight*:
28883

pI*:
7.30

Net Charge*:
0.92

EC:
1.3.99.1  

Functional Class:
energy metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)
Energy Metabolism; Oxidative phosphorylation

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum.

CPn0790 is orthologously related to CT591: residues 27-257 of CPn0790 are 74% similar to residues 1-229 of CT591, a predicted succinate dehydrogenase from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0479
COG name: Succinate dehydrogenase/fumarate reductase Fe-S protein
Functional Class: C
The phylogenetic pattern of COG0479 is amt-yQ-CEbRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MMENLETFILKIYRGVPGKQYWESFELPLHPGENVISALMEIEKRPVNIL
GEKVNPVVWEQGCLEEVCGSCSILVNGVPRQACTALIQEYIDATQSREIV
LAPLTKFPLIRDLIVDRSIMFDNLERIQGWVAADIEGETFGPQVTQEQQE
LLYALSQCMTCGCCTEACPQIDNKSDFIGPAAISQARYFNTYPGDKRSKK
RWRALMGKGGIEGCGQAHNCVRVCPKKLPLTESISAVGREISKFSLRSLF
SALFKKKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGGAGAATCTAGAGACTTTTATTTTAAAAATTTACAGAGGCGTTCC
AGGGAAGCAATACTGGGAAAGCTTTGAACTTCCTTTACATCCTGGGGAAA
ATGTTATCAGCGCTCTTATGGAAATCGAAAAGCGACCGGTAAATATCTTA
GGGGAAAAGGTCAATCCTGTAGTTTGGGAGCAGGGTTGCTTAGAAGAGGT
CTGCGGATCCTGTTCTATTCTTGTGAATGGAGTTCCTCGTCAGGCATGTA
CTGCTCTGATCCAAGAATATATCGATGCAACGCAATCCCGAGAGATTGTC
CTTGCTCCTCTTACTAAGTTCCCGTTAATCCGAGATTTAATTGTAGATAG
ATCGATTATGTTTGATAATCTCGAAAGGATTCAGGGTTGGGTTGCTGCGG
ATATTGAAGGAGAGACGTTTGGTCCTCAAGTCACTCAGGAACAGCAAGAG
CTTCTCTATGCATTGTCGCAGTGTATGACGTGTGGCTGCTGTACAGAAGC
ATGTCCCCAAATTGATAATAAAAGCGATTTCATAGGTCCTGCAGCAATTT
CCCAAGCGCGTTATTTTAATACGTATCCTGGAGATAAGCGGTCTAAGAAA
AGATGGCGGGCTCTTATGGGTAAAGGAGGGATTGAGGGTTGTGGTCAAGC
GCATAACTGTGTCCGTGTCTGCCCTAAGAAACTTCCCCTTACGGAGAGCA
TCTCGGCCGTGGGACGTGAAATTTCAAAGTTCTCTTTAAGAAGTTTATTT
TCAGCTCTTTTTAAAAAGAAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy