Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR625 IGR623 IGR624 IGR626 IGR622 IGR621 CPn0792 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 CPn0792 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 CPn0792 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0789

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sdhA  

Definition:
fumarate reductase / succinate dehydrogenaseflavoprotein component

Gene Start:
887439

Gene Stop:
889319

Gene Length:
1881

Molecular Weight*:
69560

pI*:
6.90

Net Charge*:
-0.61

EC:
1.3.99.1  

Functional Class:
energy metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCAcycle) Energy Metabolism; Oxidative phosphorylation Signal Transduction; Two-component system

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum sequences.

CPn0789 is orthologously related to CT592:
residues 1-570 are 80% similar to CT592.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1053
COG name: Succinate dehydrogenase/fumarate reductase, flavoprotein subunits
Functional Class: C
The phylogenetic pattern of COG1053 is Amt-YqvcEbRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 107 to 450 (E-value = 1e-83) place CPn0789 in the FAD_binding_2 family which is described as FAD binding domain (PF00890)
Residues 480 to 605 (E-value = 6e-52) place CPn0789 in the Succ_DH_flav_C family which is described as Fumarate reductase/succinate dehydrogenase flavoprotein C-terminal domain (PF02910)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
490  
520

PDB Hit:


Gene Protein Sequence:
MDENRKVIVVGGGLAGLSAAMQLANLGIIVELVSLTKVKRSHSVCAQGGI
NAALNLKPEEEDSPYVHAYDTIKGGDFLADQPPVLEMCLAAPRIIKMLDN
FGCPFNRGPSGNLDVRRFGGTLYHRTVFCGASTGQQLMYTLDEQVRRREH
AGRVIKRENHEFVRLVTDHSGRACGIILMNLFNNRLEILRGDAVIIATGG
PGVIFKMSTNSTFCTGAANGRLFLQGMAYANPEFIQIHPTAIPGRDKLRL
ISESVRGEGGRVWVPGDSSKRIVFPDGSERPCGETGAPWYFLEDMYPAYG
NLVSRDVGARAILRVCEAGLGIDGRMEAYLDVTHLPEKTRHKLEVVLDIY
KKFTGEDPNTVPMRIFPAVHYSMGGAWVDWPAADDPDRDSRFRQMTNIPG
CFNCGESDFQYHGANRLGANSLLSCLFAGLVSGDEASRFIEAFGASQATS
SDFDRALQQEKEENARLLSASGKENIFVLHEEIAKIMVRNVTVKRNNRDL
QETMDKLKEFRERLKNVSVLDSSPFANKSFHFVRQMGPMLELALAITKGA
LLRNEFRGSHYKPEFPERDDEHWLKTTVAVYAPEEPEISYLPVDTRHVAP
TLRDYTKSSTGKIELTNIPDNIRLPI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATGAGAATCGAAAAGTAATCGTTGTTGGTGGGGGATTGGCAGGATT
ATCCGCAGCTATGCAGTTAGCCAACCTTGGGATTATTGTAGAGCTCGTAT
CTCTGACTAAAGTCAAGCGCTCCCATTCTGTATGTGCTCAAGGGGGAATC
AACGCTGCCTTAAATCTGAAGCCTGAGGAAGAGGATTCTCCCTACGTGCA
TGCCTATGATACGATTAAAGGTGGGGATTTTCTTGCAGATCAGCCTCCTG
TCTTGGAAATGTGTCTTGCAGCACCCAGAATCATTAAAATGTTAGATAAC
TTTGGTTGTCCTTTTAACCGTGGTCCTTCTGGGAACTTAGATGTTCGTAG
ATTTGGAGGTACGTTATACCACCGCACAGTATTCTGTGGAGCTTCTACAG
GGCAGCAGCTTATGTATACTTTAGATGAGCAAGTGCGACGGCGAGAACAT
GCGGGTAGGGTGATAAAACGAGAAAATCATGAATTTGTACGTTTAGTTAC
CGACCATTCCGGACGTGCTTGCGGCATTATATTAATGAACTTGTTTAATA
ACCGTCTGGAGATTTTACGAGGCGATGCTGTCATTATAGCTACGGGAGGC
CCCGGAGTGATCTTTAAGATGTCTACAAACTCGACTTTCTGTACGGGAGC
CGCGAACGGAAGACTCTTTTTACAAGGCATGGCCTATGCAAACCCAGAGT
TTATACAAATTCACCCTACAGCAATTCCTGGAAGGGATAAGCTACGATTA
ATTTCAGAGTCTGTGCGTGGTGAGGGCGGTCGTGTGTGGGTGCCTGGGGA
TTCTTCAAAGCGCATAGTATTTCCAGATGGTTCGGAACGTCCTTGTGGAG
AGACAGGAGCTCCTTGGTATTTCTTAGAAGATATGTATCCTGCGTATGGG
AATCTTGTCAGCCGAGATGTAGGAGCGCGTGCTATTTTACGTGTATGTGA
AGCTGGATTAGGAATTGATGGACGCATGGAAGCGTACTTAGATGTCACTC
ATCTTCCCGAGAAAACACGTCATAAGTTAGAAGTCGTTTTAGATATTTAT
AAGAAATTTACTGGCGAGGACCCCAATACGGTTCCTATGAGGATTTTCCC
TGCCGTGCACTATTCTATGGGAGGTGCTTGGGTAGATTGGCCTGCTGCCG
ATGATCCTGATCGTGATAGTCGCTTCCGTCAGATGACGAATATTCCTGGA
TGTTTTAATTGTGGAGAATCTGATTTCCAATATCATGGAGCCAATCGCTT
AGGTGCTAATTCTTTACTTTCCTGTTTGTTTGCGGGTTTGGTTTCTGGAG
ATGAAGCTTCTCGTTTTATAGAGGCTTTTGGGGCATCACAGGCAACGTCT
AGTGATTTTGATCGTGCTCTACAGCAGGAAAAAGAGGAGAACGCGCGTCT
TTTATCTGCATCAGGAAAAGAGAATATTTTTGTTTTGCATGAGGAAATCG
CAAAGATTATGGTGCGAAATGTTACGGTAAAACGAAATAATCGTGATCTC
CAAGAAACTATGGATAAATTGAAAGAATTTCGTGAGAGATTAAAAAATGT
CTCTGTATTGGACTCTTCACCATTTGCGAATAAATCCTTCCATTTTGTAC
GGCAGATGGGACCCATGTTAGAACTCGCACTGGCGATTACTAAGGGAGCT
CTTCTACGCAATGAGTTTCGGGGTTCCCATTACAAACCAGAATTTCCTGA
GAGAGATGACGAGCATTGGCTGAAGACTACAGTCGCTGTTTATGCTCCTG
AAGAACCTGAGATTTCCTATCTTCCTGTGGATACTCGCCATGTAGCCCCG
ACTCTCCGGGATTACACAAAATCTTCAACAGGAAAAATAGAACTCACGAA
TATTCCTGATAATATCCGTCTACCCATATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy