Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR625 IGR623 IGR624 IGR622 IGR620 IGR621 exbB,tolQ, - CPn0785 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 CPn0791 tolR,exbD, - CPn0784 tolR,exbD, - CPn0784 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0788

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sdhC  

Definition:
succinate dehydrogenase cytochrome component

Gene Start:
886542

Gene Stop:
887435

Gene Length:
894

Molecular Weight*:
33326

pI*:
9.60

Net Charge*:
12.73

EC:
1.3.99.1  

Functional Class:
energy metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCAcycle) EnergMetabolism; Oxidative phosphorylation

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum sequences.

CPn0788 is orthologously related to CT593:
residues 110-294 are 50% similar to residues
4-187 of CT593.

COGS Summary:  COGS Search
BeTs to 4 clades of COG2142
COG name: Cytochrome b subunit of fumarate reductase and succinate dehydrogenase
Functional Class: C
The phylogenetic pattern of COG2142 is A-------ebR-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
27  
44
transmembrane  
75  
92
transmembrane  
125  
142
transmembrane  
220  
244
transmembrane  
268  
288

PDB Hit:


Gene Protein Sequence:
MSRHEICPEVSHKKGKYYSTFIFRCIHSLAGIAFTFFLCEHLFTNMLASS
YFSQGKGFVAMVNGFHKIPGLKIIEVAGLVLPFLCHAIIGIVYLFQGKSN
CYSGDGSRPHLRYAKNYSYTWQRWTAWILLFGIAFHVVHLRFIRYPVHVD
IHGTTYYAVDIQPSRYDVIVRGTKGFLTLNLPNTEASSIEVSRHDLGGAD
AALLSERNSYLLTPSAGTAFLYVVRDALGSLFIALLYTILVIAAAFHGFN
GLWTFCCRWGVVVSLRMQGVLRIVCYLAMIVVTFMGVSAVWNLYSVA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCACGACATGAAATCTGCCCAGAAGTGTCACACAAGAAAGGCAAGTA
TTATAGCACCTTTATCTTCCGTTGTATTCACTCCTTAGCGGGTATAGCGT
TTACTTTTTTCCTATGTGAACACCTATTTACGAACATGCTAGCTTCTTCT
TACTTTTCCCAGGGGAAGGGTTTCGTTGCTATGGTCAATGGTTTTCATAA
GATCCCAGGGCTGAAAATTATTGAAGTGGCGGGTTTAGTCCTTCCTTTTC
TCTGTCATGCGATTATCGGCATCGTATATCTCTTTCAAGGAAAAAGTAAT
TGTTATTCTGGTGACGGAAGTCGACCTCATTTGCGTTATGCTAAAAATTA
TAGCTATACGTGGCAAAGGTGGACTGCCTGGATTTTACTCTTTGGAATTG
CTTTCCACGTTGTGCATTTGCGTTTTATCCGTTATCCAGTCCATGTTGAT
ATCCATGGAACTACCTATTATGCTGTAGACATTCAACCTTCTCGCTATGA
CGTGATTGTTAGAGGGACTAAAGGCTTTTTAACTTTGAATCTTCCCAATA
CAGAAGCTTCGAGTATCGAGGTGTCTCGTCATGATTTAGGTGGTGCTGAT
GCTGCGTTATTGTCGGAGAGGAACTCCTATTTATTGACTCCAAGTGCAGG
TACCGCATTTCTTTATGTAGTTCGTGATGCCTTGGGATCACTATTCATAG
CTCTTCTCTATACTATTTTGGTCATTGCTGCAGCATTTCATGGGTTTAAT
GGGTTGTGGACCTTTTGTTGTCGTTGGGGTGTCGTTGTTTCTCTGAGGAT
GCAAGGGGTATTGAGGATAGTATGTTACCTCGCTATGATTGTTGTGACTT
TCATGGGAGTGAGTGCGGTTTGGAATTTGTATAGTGTGGCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy