Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR625 IGR623 IGR619 IGR624 IGR618 IGR622 IGR620 IGR621 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 CPn0791 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 tolB, - CPn0782 CPn0791 tolR,exbD, - CPn0784 tolR,exbD, - CPn0784 CPn0783 sdhB, - CPn0790 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0787

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (acidic) (possible PHP hydrolase)

Gene Start:
885619

Gene Stop:
886404

Gene Length:
786

Molecular Weight*:
29405

pI*:
5.40

Net Charge*:
-10.33

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible PHP phosphatase (ycfH) or nuclease.

Blast Summary:  PSI-Blast Search
CPn0787 is orthologously related to CT594: residues 1-261 of CPn0787 are 59% similar to residues 1-262 of CT594, a predicted conserved hypothetical protein (acidic) (possible PHP hydrolase) from C. trachomatis.
CPn0787 is also similar to UU017, TP0979, MG009, TP0994, all conserved hypothetical proteins.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0084
COG name: Predicted hydrolases of PHP superfamily
Functional Class:  R
The phylogenetic pattern of COG0084 is -mtkYqvcEbrHujgpoLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 261 (E-value = 7.3e-98) place CPn0787 in the TatD_DNase family which is described as TatD related DNase (PF01026)

PDB Hit:


Gene Protein Sequence:
VDLADAHVHLSDDAFEEDINSVLQRAQDSGVSLVVNVTTTEKELNRSFAY
AERFPKIRFCHVGGTPPQDVDQDIEEDYRNFHAAAHSKKLAAIGEVGLDY
CFATEEGIARQKEVLQRYLALSLECELPLVVHCRGAFNDFFRMLDQYYHN
DPRSRPGMLHCFTGTLEEAQELISRGWFISISGIVTFKNAQDLRDLVVEL
PLEHLLIETDAPFLAPVPYRGKKNEPAHVLHTINAVANVKGMFPQELAAL
AYKNVLRFLHG$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGATTTGGCTGATGCTCATGTTCATCTTTCTGATGATGCTTTTGAAGA
AGATATTAACAGCGTATTACAGCGCGCTCAAGATTCTGGAGTGTCACTAG
TTGTTAATGTAACCACAACAGAAAAGGAATTAAATCGCTCGTTTGCGTAT
GCCGAACGTTTTCCTAAAATTCGATTTTGCCATGTTGGAGGGACTCCCCC
TCAAGATGTAGATCAGGATATCGAAGAAGACTACAGGAATTTTCATGCTG
CAGCACATAGTAAGAAACTCGCCGCAATCGGAGAGGTCGGTTTAGATTAT
TGCTTTGCCACGGAAGAGGGAATAGCAAGGCAGAAAGAGGTTCTCCAACG
CTATTTGGCTTTATCTTTAGAATGCGAACTCCCACTTGTAGTGCATTGTC
GAGGTGCTTTTAACGATTTTTTCCGTATGCTAGACCAATACTACCATAAC
GATCCACGTTCACGTCCAGGGATGCTGCATTGCTTTACAGGAACCTTGGA
AGAAGCTCAGGAACTGATCTCTCGGGGATGGTTTATTTCTATAAGTGGGA
TCGTGACTTTTAAAAATGCTCAAGATTTGCGAGATCTGGTTGTAGAACTT
CCTCTTGAGCATCTTTTAATAGAGACGGATGCGCCTTTTCTGGCTCCTGT
ACCTTATCGGGGAAAGAAAAATGAGCCTGCACATGTGCTCCATACGATCA
ACGCCGTTGCCAATGTAAAAGGGATGTTCCCACAAGAGCTTGCAGCTCTT
GCTTACAAGAACGTCTTACGCTTTCTGCACGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy