Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR623 IGR619 IGR618 IGR617 IGR622 IGR620 IGR621 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tolR,exbD, - CPn0784 pal, - CPn0781 tolR,exbD, - CPn0784 pal, - CPn0781 CPn0780 CPn0779 tsa, - CPn0778 CPn0787 sdhC, - CPn0788 sdhA, - CPn0789 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0785

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
exbB  tolQ  

Definition:
probable biopolymer transport (tolQ) protein

Gene Start:
882991

Gene Stop:
882293

Gene Length:
699

Molecular Weight*:
25560

pI*:
8.60

Net Charge*:
3.82

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:
This protein is involved in tonB-independent uptake of colicins.
In E.coli, the exbB/tolQ gene was formerly known as fii.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to biopolymer transport proteins; e.g. residues 1-232 are 75% similar to CT596, a probable biopolymer transport (tolQ) protein; residues 9-213 are 30% similar to (AJ235271) TOLQ PROTEIN (tolQ) [Rickettsia prowazekii]; residues 20-224 are 27% similar to (AE000766) TolQ homolog [Aquifex aeolicus]; and residues 125-211 are 43% similar to (AE001556) BIOPOLYMER TRANSPORT PROTEIN [Helicobacter pylori J99].
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0811
COG name: Biopolymer transport proteins
Functional Class: N
The phylogenetic pattern of COG0811 is --t--Q-CE--HUJ----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 23-41, 137-160, and 173-199 represent BP03317A-C (TRANSPORT PROTEIN TRANSMEMBRA) with a combined E-value of 1.3e-27.

ProDom Summary:  Protein Domain Search
Residues 125-211 are 43% similar to a defined domain of EXB2_HELPY, defined as: TRANSPORT PROTEIN TRANSMEMBRANE INNER MEMBRANE BIOPOLYMER EXBB PUTATIVE EXBB-LIKE TOLQ.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 81 to 217 (E-value = 6.1e-52) place CPn0785 in the MotA_ExbB family which is described as MotA/TolQ/ExbB proton channel family (PF01618)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
22  
39
transmembrane  
139  
160
transmembrane  
181  
198

PDB Hit:


Gene Protein Sequence:
MVHFSHNPIIQAYTEADFFGKSIFFCLLILSVCTWTVLHQKLAIQKNFLK
AGKSLKDFLIKNRHAPLSLDIHPELSPFADLYFTIKRGTLELLDKNRQSA
PDRGPILSSEDIQSLETLLGAIMPKYKALLHKNSFIPATTISLAPFLGLL
GTVWGILVAFTHISSGSSGNSAIMEGLATALGTTIIGLFVAIPSLIAFNY
LKAHSSELISEIEQTAYLLLNSIEVKYRNTNL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTACACTTCTCTCATAACCCCATCATTCAGGCCTACACGGAAGCAGA
TTTTTTTGGTAAAAGTATATTCTTTTGTCTTCTTATTCTTTCTGTGTGTA
CTTGGACAGTACTACATCAAAAGCTTGCCATTCAAAAAAATTTTTTAAAA
GCAGGAAAGTCTCTTAAAGATTTCTTAATTAAAAACCGTCACGCACCTCT
GTCTCTGGATATCCATCCAGAGCTCAGCCCCTTTGCGGACTTGTATTTTA
CTATAAAACGGGGAACTTTGGAGCTCTTAGATAAAAATCGGCAATCGGCT
CCAGATCGAGGTCCCATCCTTTCTTCTGAAGATATCCAATCTTTGGAGAC
GCTCCTGGGAGCCATCATGCCGAAATATAAAGCTCTTTTACATAAAAACA
GCTTTATTCCGGCGACAACGATCAGCTTAGCTCCTTTTCTAGGACTTTTA
GGTACAGTATGGGGAATTTTAGTCGCTTTTACCCACATTAGCTCGGGAAG
CAGTGGAAACTCAGCCATTATGGAAGGACTCGCCACAGCCCTGGGAACGA
CGATTATAGGACTCTTTGTTGCTATACCCTCACTGATCGCTTTTAACTAT
CTTAAAGCACATTCTTCGGAATTGATTTCTGAGATAGAGCAGACAGCATA
TTTACTACTGAATTCTATAGAAGTCAAATACCGCAATACAAACTTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy