Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR619 IGR618 IGR617 IGR622 IGR620 IGR621 IGR616 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0787 sdhC, - CPn0788 groEL, - CPn0777 dsbD,dipZ, - CPn0786 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0787 sdhC, - CPn0788 groEL, - CPn0777 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tolR,exbD, - CPn0784 pal, - CPn0781 tolR,exbD, - CPn0784 pal, - CPn0781 CPn0780 CPn0779 tsa, - CPn0778 CPn0787 sdhC, - CPn0788 groEL, - CPn0777 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0784

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tolR  exbD  

Definition:
probable biopolymer transfer (tolR) protein

Gene Start:
882296

Gene Stop:
881889

Gene Length:
408

Molecular Weight*:
15161

pI*:
4.60

Net Charge*:
-8.80

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to biopolymer transport protein sequences; e.g. residues 1-135 are 54% similar to CT597, a probable biopolymer transfer (tolR) protein; residues 15-126 are 25% similar to EXBD_ECOLI; and residues 15-125 are 26% similar to EXB1_XANCP.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0848
COG name: Biopolymer transport protein ExbD
Functional Class: N
The phylogenetic pattern of COG0848 is -----Q-CE--HUJ----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 15-121 are 25% similar to a defined domain of EXBD_HAEIN, defined as: TRANSPORT PROTEIN BIOPOLYMER TRANSMEMBRANE EXBD INNER MEMBRANE PUTATIVE EXBD-LIKE.
Residues 16-104 are 24% similar to a defined domain of EXBD_VIBCH, defined as: BIOPOLYMER TRANSPORT EXBD PROTEIN. TRANSPORT; PROTEIN TRANSPORT; TRANSMEMBRANE; INNER MEMBRANE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
21  
38

PDB Hit:


Gene Protein Sequence:
MKYRFTEEIEEEPLVNLTPLIDIVFVILMAFIVAVPLIKLDSIALAPGTQ
EQEVLSSENDSIAVIKVFADHSLTLNEHPITLQELTVRLTLLHKAYPEKT
PLLLQDGETSFRTYQNVKNAIEAAGFHELHVALQN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATACCGCTTCACGGAAGAAATAGAAGAAGAGCCCCTGGTGAACTT
AACGCCGTTGATTGATATTGTCTTTGTCATTTTAATGGCATTTATCGTTG
CTGTTCCCTTAATAAAACTGGATTCTATAGCTCTTGCTCCTGGCACACAA
GAGCAAGAAGTGCTGAGCAGCGAAAACGATTCTATAGCGGTAATTAAAGT
ATTTGCGGACCATTCGTTAACTTTGAACGAGCATCCGATCACACTACAAG
AGCTCACTGTTCGCCTTACCCTCCTCCATAAAGCCTATCCTGAAAAGACC
CCCCTATTACTACAAGATGGAGAAACCTCCTTTCGGACATATCAAAACGT
AAAGAATGCTATAGAAGCTGCGGGGTTTCACGAACTTCACGTAGCCCTAC
AGAATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy