Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR619 IGR618 IGR617 IGR622 IGR620 IGR621 IGR616 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0787 groEL, - CPn0777 dsbD,dipZ, - CPn0786 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0787 groEL, - CPn0777 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tolR,exbD, - CPn0784 pal, - CPn0781 tolR,exbD, - CPn0784 pal, - CPn0781 CPn0780 CPn0779 tsa, - CPn0778 CPn0787 groEL, - CPn0777 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0783

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
881885

Gene Stop:
881097

Gene Length:
789

Molecular Weight*:
28996

pI*:
10.50

Net Charge*:
18.01

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0783 is orthologously related to CT598: residues 3-262 of CPn0783 are 35%
similar to residues 5-235 of CT598, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.
No significant similarity to T. pallidum, M. genitalium, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
171

PDB Hit:


Gene Protein Sequence:
MMKYLPYIAITACIHGGILLLVFASPLPKKRLQPKAFQEKLVTIQPKPPV
PTPSVVVDPAKTIRPSVATQPQKQAKCSPPQENVQKALQKPIPKVIKTEP
PKPSPAPTVAKKTTATEKPPPSTTKKNTQLSKTQLQTLSEVAQALSLHVD
KIEKSETSLKNISWPSTAQLTMHSELKATQEDELCELFRTHIALPSKGYV
RIKLVLSPNGEIQECSFLSEVSAADKQLLTQRIQALPFQKFLEKYKVSKN
ISFHIKLVSNES$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAGTATCTTCCCTATATAGCAATCACGGCATGTATTCATGGGGG
GATTCTTCTCCTTGTCTTTGCTTCTCCTCTTCCTAAAAAACGTTTACAAC
CCAAAGCCTTTCAAGAAAAACTCGTCACTATCCAACCGAAACCTCCTGTC
CCTACTCCCTCAGTAGTTGTAGATCCAGCTAAAACGATACGCCCCTCTGT
AGCTACGCAGCCACAAAAACAAGCTAAATGCAGCCCTCCTCAAGAGAACG
TCCAGAAGGCTCTACAAAAACCCATTCCAAAAGTTATAAAAACAGAACCT
CCTAAACCATCACCAGCCCCTACTGTAGCAAAAAAAACGACCGCAACTGA
GAAACCTCCTCCCTCTACAACTAAAAAAAATACACAGTTATCAAAAACCC
AACTACAAACACTCTCCGAAGTTGCCCAAGCCCTTTCCCTACATGTAGAT
AAAATTGAGAAAAGTGAAACTTCTCTCAAAAATATCTCCTGGCCATCTAC
AGCCCAATTGACCATGCACTCAGAACTTAAAGCAACTCAAGAAGACGAGC
TATGTGAGTTATTTCGCACTCACATAGCTCTCCCCTCTAAAGGGTATGTG
CGTATTAAATTAGTCCTTTCTCCGAATGGAGAGATTCAAGAATGCAGTTT
TCTCTCTGAGGTGAGTGCTGCTGACAAACAGCTGCTCACTCAGAGGATTC
AAGCACTCCCATTTCAAAAATTTCTCGAAAAATACAAAGTCTCGAAAAAT
ATATCTTTTCATATTAAACTGGTCAGTAATGAATCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy