Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR619 IGR618 IGR617 IGR615 IGR620 IGR621 IGR616 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tolR,exbD, - CPn0784 pal, - CPn0781 tolR,exbD, - CPn0784 pal, - CPn0781 CPn0780 CPn0779 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0782

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tolB  

Definition:
tolB protein precursor

Gene Start:
881065

Gene Stop:
879770

Gene Length:
1296

Molecular Weight*:
47749

pI*:
9.30

Net Charge*:
11.98

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to tolB protein sequences; e.g. residues 16-430 are 58% similar to CT599, a tolB protein precursor; residues 125-422 are 26% similar to TOLB_ECOLI; residues 121-387 are 29% similar to (AJ235271) TOLB PROTEIN PRECURSOR (tolB) [Rickettsia prowazekii]; and residues 101-422 are 24% similar to TOLB_HAEIN.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0823
COG name: Periplasmic component of the Tol biopolymer transport system
Functional Class: N
The phylogenetic pattern of COG0823 is a------Ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 125-419 are 26% similar to a defined domain of TOLB_ECOLI, defined as: PROTEIN TRANSPORT TOLB COLICIN PRECURSOR PERIPLASMIC SIGNAL TOLERANCE-LIKE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 152 (E-value = 1.2e-58) place CPn0782 in the TolB_N family which is described as TolB amino-terminal domain (PF04052)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
20
non-globular  
50  
136

PDB Hit:


Gene Protein Sequence:
MLRQLCFQVFFFCFASLVYAEELEVVVRSEHITLPIEVSCQTDTKDPKIQ
KYLSSLTEIFCKDIALGDCLQPTAASKESSSPLAISLRLHVPQLSVVLLQ
SSKTPQTLCSFTISQNLSVDRQKIHHAADTVHYALTGIPGISAGKIVFAL
SSLGKDQKLKQGELWTTDYDGKNLAPLTTECSLSITPKWVGVGSNFPYLY
VSYKYGVPKIFLGSLENTEGKKVLPLKGNQLMPTFSPRKKLLAFVADTYG
NPDLFIQPFSLTSGPMGRPRRLLNENFGTQGNPSFNPEGSQLVFISNKDG
RPRLYIMSLDPEPQAPRLLTKKYRNSSCPAWSPDGKKIAFCSVIKGVRQI
CIYDLSSGEDYQLTTSPTNKESPSWAIDSRHLVFSAGNAEESELYLISLV
TKKTNKIAIGVGEKRFPSWGAFPQQPIKRTL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTACGGCAACTATGCTTCCAAGTTTTTTTCTTTTGCTTCGCATCGCT
AGTCTATGCTGAAGAATTAGAAGTTGTTGTCCGTTCCGAACATATCACGC
TCCCTATTGAGGTCTCTTGCCAGACCGATACGAAAGATCCAAAAATACAG
AAATACCTCAGCTCGCTAACGGAGATATTTTGCAAGGACATTGCCCTAGG
AGATTGTCTACAACCCACAGCGGCTTCTAAAGAATCGTCATCTCCTTTAG
CAATATCTTTACGGTTGCATGTACCTCAGCTATCTGTAGTGCTTTTACAG
TCTTCAAAAACTCCTCAAACCTTATGTTCTTTTACTATTTCTCAAAATCT
TTCTGTAGATCGTCAAAAAATCCATCACGCTGCTGATACAGTTCATTACG
CCCTCACAGGGATTCCTGGAATCAGTGCTGGGAAAATTGTTTTTGCTCTA
AGTTCTTTAGGAAAAGATCAAAAGCTCAAGCAAGGAGAATTATGGACTAC
AGATTACGATGGGAAAAACCTCGCCCCTTTAACCACAGAATGTTCGCTCT
CTATAACTCCAAAATGGGTGGGTGTGGGATCAAATTTTCCCTATCTCTAT
GTTTCGTATAAGTATGGTGTGCCTAAAATTTTTCTTGGTTCCCTAGAGAA
CACTGAAGGTAAAAAAGTCCTTCCGTTAAAAGGCAACCAACTCATGCCTA
CGTTTTCTCCAAGAAAAAAGCTTTTAGCTTTCGTTGCTGATACGTATGGA
AATCCTGATTTATTTATTCAACCGTTCTCACTAACTTCAGGACCTATGGG
TCGCCCACGTCGCCTCCTTAATGAGAATTTCGGGACTCAAGGGAATCCCT
CCTTCAACCCTGAAGGATCCCAGCTTGTCTTTATATCGAACAAAGACGGC
CGTCCGCGTCTTTATATTATGTCCCTCGATCCTGAACCCCAAGCACCTCG
CTTGCTGACAAAAAAATACAGAAATAGCAGTTGCCCTGCATGGTCTCCAG
ATGGTAAAAAAATAGCCTTCTGCTCTGTAATTAAAGGGGTGCGACAAATT
TGTATTTACGATCTCTCCTCTGGAGAGGATTACCAACTCACTACGTCTCC
CACAAATAAAGAGAGTCCTTCTTGGGCTATAGACAGCCGTCATCTTGTCT
TTAGTGCGGGGAATGCTGAAGAATCAGAGTTATATTTAATCAGTCTAGTC
ACCAAAAAAACTAACAAAATTGCTATAGGAGTAGGAGAAAAACGGTTCCC
CTCCTGGGGTGCTTTCCCTCAGCAACCGATAAAGAGAACACTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy