Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR619 IGR618 IGR617 IGR615 IGR620 IGR616 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786 CPn0779 CPn0780 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tolR,exbD, - CPn0784 pal, - CPn0781 tolR,exbD, - CPn0784 pal, - CPn0781 CPn0780 CPn0779 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0781

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pal  

Definition:
peptidoglycan-associated lipoprotein

Gene Start:
879773

Gene Stop:
879195

Gene Length:
579

Molecular Weight*:
21910

pI*:
9.30

Net Charge*:
6.97

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0781 is orthologously related to CT600: residues 12-192 of CPn0781 are 67% similar to residues 12-188 of CT600, a predicted peptidoglycan-associated lipoprotein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1360
COG name: Flagellar motor protein MotB
Functional Class:  N
The phylogenetic pattern of COG1360 is -----Qv-EBrHUJ--OLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 87 to 183 (E-value = 5.5e-27) place CPn0781 in the OmpA family which is described as OmpA family (PF00691)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
22

PDB Hit:


Gene Protein Sequence:
MNIHSLWKLCTLLALLALPACSLSPNYGWEDSCNTCHHTRRKKPSSFGFV
PLYTEEDFNPNFTFGEYDSKEEKQYKSSQVAAFRNITFATDSYTIKGEEN
LAILTNLVHYMKKNPKATLYIEGHTDERGAASYNLALGARRANAIKEHLR
KQGISADRLSTISYGKEHPLNSGHNELAWQQNRRTEFKIHAR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATACATTCCCTATGGAAACTTTGTACTTTATTGGCTTTACTTGC
ATTGCCAGCATGTAGCCTTTCCCCTAATTATGGCTGGGAGGATTCCTGTA
ATACATGCCATCATACAAGACGAAAAAAGCCTTCTTCTTTTGGCTTTGTT
CCTCTCTATACCGAAGAGGACTTTAACCCTAATTTTACCTTCGGTGAGTA
TGATTCCAAAGAAGAAAAACAATACAAGTCAAGCCAAGTTGCAGCATTTC
GTAATATCACCTTTGCTACAGACAGCTATACAATTAAAGGTGAAGAGAAC
CTTGCGATTCTCACGAACTTGGTTCACTACATGAAGAAAAACCCGAAAGC
TACACTGTACATTGAAGGGCATACTGACGAGCGTGGAGCTGCATCCTATA
ACCTTGCTTTAGGAGCACGACGAGCCAATGCGATTAAAGAGCATCTCCGA
AAGCAGGGAATCTCTGCAGATCGTCTATCTACTATTTCCTACGGAAAAGA
ACATCCTTTAAATTCGGGACACAACGAACTAGCATGGCAACAAAATCGCC
GTACAGAGTTTAAGATTCATGCACGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy