Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR619 IGR618 IGR617 IGR615 IGR620 IGR614 IGR616 CPn0779 CPn0780 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786 CPn0779 CPn0780 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tolR,exbD, - CPn0784 pal, - CPn0781 tolR,exbD, - CPn0784 pal, - CPn0781 CPn0780 CPn0779 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0780

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (basic) (probable invasin repeat phosphatase)

Gene Start:
879205

Gene Stop:
878588

Gene Length:
618

Molecular Weight*:
22846

pI*:
8.80

Net Charge*:
3.82

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0780 is orthologously related to CT601: residues 21-204 of CPn0780 are 52% similar to residues 16-200 of CT601, a predicted conserved hypothetical protein (basic) (probable invasin repeat phosphatase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1388
COG name: Predicted lytic murein transglycosylase
Functional Class:  N
The phylogenetic pattern of COG1388 is -----q--eB-h----o-IN-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 159 to 201 (E-value = 2.1e-18) place CPn0780 in the LysM family which is described as LysM domain (PF01476)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21
coil-coil  
32  
66
coil-coil  
78  
134

PDB Hit:


Gene Protein Sequence:
MHAKLSFFILLSLLFSGIDCSRLHAAGRSPSLQGVLAEIEDISAKLASHE
VEIVMLSERLDEQDSKCQKWTAAKPETLAQKIRELESDQKALAKTLAVLT
TSVKDLQTNLQSKLQEIQKDHRALAQDLRLVRRSLLALVDSSSPGAYADF
SDPVPENIYIVREGDSLSKIAKKYKLSVTELKKINKLDSDAIYAGQRLCL
QRNKQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACGCTAAGCTAAGCTTTTTTATTCTTCTAAGTCTGTTATTTTCAGG
AATAGATTGCAGTCGTTTGCATGCTGCTGGAAGGTCTCCTTCTCTACAAG
GAGTCCTTGCAGAAATCGAAGATATCTCGGCAAAATTAGCCTCTCACGAA
GTGGAGATTGTCATGTTGTCAGAGCGCTTGGATGAACAAGACTCTAAATG
CCAAAAATGGACAGCAGCAAAACCAGAAACCCTGGCTCAAAAAATCCGCG
AGCTAGAGTCCGATCAAAAGGCGCTTGCGAAAACATTAGCTGTACTAACA
ACTTCTGTTAAAGACTTACAGACGAACTTACAAAGTAAACTACAAGAAAT
TCAAAAAGATCACCGAGCTTTAGCTCAGGATTTGCGTCTAGTACGACGTT
CTTTACTTGCTTTAGTAGACAGCTCTTCTCCTGGAGCCTATGCTGACTTC
TCGGATCCTGTTCCTGAGAATATTTATATAGTACGTGAAGGTGATAGTCT
TAGTAAAATTGCTAAAAAATATAAACTTTCAGTAACTGAATTAAAGAAAA
TTAATAAATTAGATTCCGATGCTATCTATGCTGGGCAACGACTTTGTTTA
CAAAGAAATAAGCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy