Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR619 IGR618 IGR617 IGR615 IGR620 IGR614 IGR616 CPn0779 CPn0780 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 CPn0774 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786 CPn0779 CPn0780 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 CPn0774 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tolR,exbD, - CPn0784 pal, - CPn0781 tolR,exbD, - CPn0784 pal, - CPn0781 CPn0780 CPn0779 CPn0774 tsa, - CPn0778 CPn0776 groEL, - CPn0777 dsbD,dipZ, - CPn0786
* Calculated from Protein Sequence

Gene ID: CPn0779

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
878481

Gene Stop:
878092

Gene Length:
390

Molecular Weight*:
14641

pI*:
6.00

Net Charge*:
-2.95

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0779 is orthologously related to CT602: residues 1-125 of CPn0779 are 64% similar to residues 1-127 of CT602, a predicted hypothetical protein (acidic) from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKFTVALFGEAEKGSYDTAYFCRSLVDLHNYLGDVSSPGITLAIKTLLSD
YNVVYFRVREEGYCVDSYFFGLHFLNTQTTLKNIIAIGLPGVGNQHIIEA
SRSLCQKHNSLLLFFDHDLYDLLTFNQPF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTTACAGTTGCTTTATTTGGAGAAGCAGAAAAAGGAAGTTACGA
TACTGCGTACTTCTGTCGTAGTCTTGTAGATCTACATAATTATCTTGGAG
ATGTCAGCAGTCCAGGCATCACTTTAGCTATTAAAACATTATTAAGTGAT
TATAATGTAGTGTACTTCAGAGTTCGAGAAGAAGGCTACTGTGTAGATAG
TTACTTTTTTGGTTTGCATTTCTTAAATACACAAACGACGTTAAAAAACA
TCATTGCTATCGGACTTCCTGGTGTTGGAAATCAACACATCATTGAAGCT
TCTCGGTCTTTATGCCAAAAACACAATAGCCTTTTATTGTTCTTTGATCA
CGATCTTTATGACTTGCTGACTTTCAATCAGCCTTTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy