Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR619 IGR618 IGR617 IGR615 IGR614 IGR616 CPn0779 CPn0780 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0779 CPn0780 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0775 exbB,tolQ, - CPn0785 CPn0783 tolB, - CPn0782 tolR,exbD, - CPn0784 pal, - CPn0781 tolR,exbD, - CPn0784 pal, - CPn0781 CPn0780 CPn0779 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0774 CPn0774
* Calculated from Protein Sequence

Gene ID: CPn0778

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tsa  

Definition:
thiol specific antioxidant (thioredoxin peroxidase)

Gene Start:
877505

Gene Stop:
878095

Gene Length:
591

Molecular Weight*:
21884

pI*:
4.60

Net Charge*:
-11.74

EC:
 

Functional Class:
cellular processes; detoxification  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to thioredoxin peroxidase sequences; e.g. residues 3-195 are 48% similar to BAS1_WHEAT; residues 3-195 are 49% similar to (AF076920) thioredoxin peroxidase [Secale cereale]; residues 6-192 are 48% similar to TDX1_MOUSE; residues 10-194 are 46% similar to (AF034959) thioredoxin peroxidase [Echinococcus granulosus]; residues 4-196 are 65% similar to CT603; and residues 4-183 are 33% similar to TP0509.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0450
COG name: Thiol - alkyl hydroperoxide reductases
Functional Class:  O
The phylogenetic pattern of COG0450 is amtkYQvCeBR-uj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 33-84, 97-115, and 125-174 represent blocks BP00721A-C (ANTIOXIDANT PROTEIN REDUCTASE P) with a combined E-value of 1.6e-64.

ProDom Summary:  Protein Domain Search
Residues 6-81 are 59% similar to a defined domain of TDX1_MOUSE, defined as: PROTEIN ANTIOXIDANT PEROXIDASE REDUCTASE PEROXIDE THIOREDOXIN-DEPENDENT PROBABLE THIOREDOXIN OXIDOREDUCTASE ALKYL.
Residues 100-159 are 53% similar to a defined domain of TDX2_HUMAN, defined as: ANTIOXIDANT PROTEIN REDUCTASE PEROXIDASE PEROXIDE THIOREDOXIN-DEPENDENT THIOREDOXIN ALKYL PEROXIREDOXIN THIOL-SPECIFIC.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 155 (E-value = 6.4e-64) place CPn0778 in the AhpC-TSA family which is described as AhpC/TSA family (PF00578)

PDB Hit:


Gene Protein Sequence:
MTLSLVGKEAPDFVAQAVVNGETCTVSLKDYLGKYVVLFFYPKDFTYVCP
TELHAFQDALGEFHTRGAEVIGCSVDDIATHQQWLATKKKQGGIEGITYP
LLSDEDKVISRSYHVLKPEEELSFRGVFLIDKGGIIRHLVVNDLPLGRSI
EEELRTLDALIFFETNGLVCPANWHEGERAMAPNEEGLQNYFGTID$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACTCTCCCTAGTTGGAAAGGAAGCCCCTGATTTTGTTGCGCAAGC
TGTTGTTAATGGCGAAACGTGTACCGTATCTTTAAAAGATTATTTAGGAA
AGTATGTTGTGCTTTTCTTCTATCCTAAAGATTTTACTTACGTGTGTCCT
ACGGAATTGCACGCATTTCAAGATGCTTTAGGAGAATTCCACACCCGAGG
AGCTGAAGTCATAGGCTGTTCCGTGGATGACATTGCCACCCATCAACAGT
GGTTAGCTACTAAGAAAAAGCAAGGTGGTATCGAAGGTATTACCTATCCT
CTTCTCTCAGACGAAGATAAAGTCATTTCAAGAAGTTATCATGTGTTAAA
ACCCGAAGAAGAATTATCTTTCAGAGGAGTTTTCCTGATTGATAAAGGTG
GAATCATCCGTCATCTTGTAGTGAATGATCTTCCTCTAGGCCGTTCTATA
GAAGAAGAACTTAGAACCCTAGATGCTTTAATCTTCTTTGAAACTAATGG
CTTAGTCTGTCCTGCAAATTGGCATGAAGGAGAGCGAGCGATGGCTCCAA
ATGAAGAAGGACTGCAAAATTATTTCGGGACTATAGACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy