Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR618 IGR613 IGR617 IGR615 IGR614 IGR616 CPn0779 CPn0780 CPn0775 CPn0783 tolB, - CPn0782 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0779 CPn0780 CPn0775 CPn0783 tolB, - CPn0782 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0775 CPn0783 tolB, - CPn0782 uvrD, - CPn0772 pal, - CPn0781 pal, - CPn0781 CPn0780 CPn0779 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0774 CPn0774
* Calculated from Protein Sequence

Gene ID: CPn0777

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
groEL  

Definition:
heat shock protein 60

Gene Start:
875601

Gene Stop:
877181

Gene Length:
1581

Molecular Weight*:
56882

pI*:
6.20

Net Charge*:
-4.41

EC:
 

Functional Class:

Pathway: pathway table

Primary Evidence:
Cerrone MC, Ma JJ, Stephens RS. 1991. Cloning and sequence of the gene for heat shock protein
60 from Chlamydia trachomatis and immunological reactivity of the protein. Infect. Immun.
59(1):79-90.

Ho Y and Zhang YX. 1994. The sequence of the groES and groEL genes from the
mouse pneumonitis agent of Chlamydia trachomatis. Gene 141(1): 143-144.

Mayr M, Metzler B, Kiechl S, Willeit J, Schett G, Xu QB, Wick G. 1999. Endothelial cytotoxicity mediated by
serum antibodies to heat shock proteins of Escherichia coli and Chlamydia pneumoniae: Immune
reactions to heat shock proteins as a possible link between infection and atherosclerosis.
Circulation 99(12): 1560-1566.

Comment:
For a review of the heat shock response the user is refered to the 1999 Yura and Nakahigashi review article, "Regulation of the heat-shock response." Current Opinion in Microbiology 2(2): 153-158.

Chaperonins form oligomeric complexes composed of two different types of
subunits: a 60 kD protein, known as cpn60 (or GroEL) that is highly conserved (see CPn0134, CPn0777 and CPn0898)
and a 10 kD, protein, known as cpn10 (or GroES) (see CPn0135).

From Prosite PDOC00268:

Chaperonins are proteins involved in the folding of proteins or the assembly
of oligomeric protein complexes. Their role seems to be to assist other
polypeptides to maintain or assume conformations which permit their correct
assembly into oligomeric structures. They are found in abundance in
prokaryotes, chloroplasts and mitochondria. Chaperonins form oligomeric
complexes and are composed of two different types of subunits: a 60 kD
protein, known as cpn60 (groEL in bacteria) and a 10 kD protein, known as
cpn10 (groES in bacteria).

The cpn60 protein shows weak ATPase activity and is a highly conserved
protein of about 550 to 580 amino acid residues which has been described by
different names in different species.

Blast Summary:  PSI-Blast Search
CPn0777 is orthologously related to CT110: residues 10-521 of CPn0777 are 35% similar to residues 11-524 of CT110, a predicted 60 kD chaperonin (protein CPN60; GroEL protein) & a 57 kD
chlamydial hypersensitivity antigen (HSP60) from C. trachomatis.
CPn0777 is also similar to TP0030, CT604, MG392, CT755, all predicted heat shock proteins.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0459
COG name: Chaperonin GroEL (HSP60 family)
Functional Class:  O
The phylogenetic pattern of COG0459 is AmTkYqvCebRhujgpolINx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0777 is paralogous to CPn0134 and CPn0898: residues 10-521 of CPn0777 are 35% similar to residues 11-524 of CPn0134; residues 7-520 of CPn0777 are 27% similar to residues 8-509 of CPn0898. Both are predicted heat shock proteins from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 22 to 524 (E-value = 8.1e-164) place CPn0777 in the Cpn60_TCP1 family which is described as TCP-1/cpn60 chaperonin family (PF00118)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
37  
144

PDB Hit:


Gene Protein Sequence:
VVWVFKSQFEGLSALKRGVHALTKAVTPAFGPRGYNVVIKKGKAPIVLTK
NGIRIAKEIILQDAFESLGVKLAKEALLKVVEQTGDGSTTALVVIDALFT
QGLKGIAAGLDPQEIKAGILLSVEMVYQQLQRQAIELQSPKDVLHVAMVA
ANHDVTLGTVVATVISQADLKGVFSSKDSGISKTRGLGKRVKSGYLSPYF
VTRPETMDVVWEEALVLILSHSLVSLSEELIRYLELISEQNTHPLVIIAE
DFDQNVLRTLILNKLRNGLPVCAVKAPGSRELRQVVLEDLAILTGATLIG
QESENCEIPVSLDVLGRVKQVMITKETFTFLEGGGDAEIIQARKQELCLA
IARSTSESECQELEERLAIFIGSIPQVQITADTDTEQRERQFQLESALRA
TKAAMKGGIVPGGGVAFLRAAHAIEVPANLSSGMTFGFETLLQAVRTPLK
VLAQNCGRSSEEVIHTILSHENPRFGYNGMTDTFEDLVDAGICDPLIVTT
SSLKCAVSVSCLLLTSSFFISSRTKT$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTTTGGGTATTTAAAAGTCAATTTGAGGGACTTTCAGCATTAAAACG
AGGAGTGCATGCTCTTACTAAAGCTGTAACCCCAGCATTTGGACCTCGAG
GGTATAACGTAGTCATCAAAAAAGGAAAAGCTCCTATTGTCTTAACGAAA
AACGGAATTCGGATTGCTAAAGAAATCATACTTCAAGACGCATTCGAATC
TCTTGGAGTAAAGCTTGCAAAGGAAGCCTTGCTAAAAGTTGTAGAACAAA
CTGGAGATGGCTCAACAACAGCCCTTGTTGTTATCGATGCTCTTTTTACT
CAGGGTCTAAAAGGCATTGCTGCAGGTCTAGATCCTCAGGAGATCAAAGC
AGGCATTCTCTTGTCAGTGGAGATGGTCTACCAGCAATTACAAAGGCAAG
CTATAGAGTTACAGTCTCCAAAAGACGTTTTGCATGTCGCTATGGTTGCG
GCAAACCATGATGTTACTTTAGGTACCGTGGTAGCAACTGTCATATCCCA
AGCCGATCTTAAAGGCGTCTTCTCTAGCAAAGACTCTGGAATTTCCAAAA
CACGTGGTTTAGGAAAAAGAGTAAAAAGTGGATACCTTTCTCCCTATTTT
GTTACGCGTCCAGAGACAATGGATGTTGTGTGGGAAGAAGCTTTAGTGCT
CATCCTATCCCATAGCCTAGTGTCTTTAAGTGAAGAACTGATTCGGTATT
TAGAACTCATCTCTGAACAGAACACCCACCCCTTAGTGATCATAGCAGAA
GATTTTGATCAGAATGTTTTAAGAACTCTGATTTTGAATAAGCTTAGAAA
CGGTCTTCCTGTTTGTGCTGTGAAGGCTCCAGGATCTAGAGAACTGCGAC
AAGTCGTTTTGGAAGATCTTGCTATTTTAACGGGAGCTACCCTTATAGGA
CAAGAATCAGAAAACTGTGAAATACCAGTTTCCTTAGATGTTTTGGGGCG
TGTGAAACAGGTCATGATTACTAAAGAAACGTTTACCTTCCTTGAGGGAG
GGGGAGATGCTGAGATCATACAAGCTAGGAAACAGGAGCTCTGTTTAGCG
ATAGCTAGGAGTACCTCAGAGAGTGAGTGTCAGGAATTAGAAGAACGGTT
AGCGATCTTTATAGGAAGTATCCCGCAAGTGCAAATTACTGCCGATACGG
ATACAGAACAAAGGGAACGACAGTTCCAGTTAGAATCTGCCTTACGTGCT
ACAAAAGCTGCCATGAAAGGTGGGATAGTTCCTGGTGGGGGAGTGGCTTT
CTTACGAGCAGCACACGCTATCGAGGTGCCTGCAAACCTATCTTCGGGTA
TGACTTTTGGTTTTGAGACTCTCCTACAAGCGGTACGAACTCCCTTGAAG
GTTTTAGCTCAGAACTGTGGTAGATCTTCAGAAGAAGTCATTCATACCAT
TCTCTCTCACGAGAACCCTAGATTTGGCTATAATGGCATGACAGATACAT
TCGAGGATCTTGTAGATGCAGGGATCTGCGATCCCCTCATTGTAACAACC
TCTTCATTAAAATGCGCAGTTTCGGTATCATGCCTCTTGCTAACGAGTTC
TTTTTTTATCAGCTCAAGGACGAAAACATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy