Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR612 IGR613 IGR617 IGR615 IGR614 IGR616 CPn0779 CPn0780 CPn0775 tolB, - CPn0782 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0779 CPn0780 CPn0775 tolB, - CPn0782 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 pal, - CPn0781 CPn0780 tolB, - CPn0782 pal, - CPn0781 CPn0779 tsa, - CPn0778 ung, - CPn0773 CPn0776 groEL, - CPn0777 CPn0774 CPn0774
* Calculated from Protein Sequence

Gene ID: CPn0776

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (YBBC related)

Gene Start:
874246

Gene Stop:
875490

Gene Length:
1245

Molecular Weight*:
46523

pI*:
8.10

Net Charge*:
5.89

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two significant hits in gapped BLAST to hypothetical protein sequence; e.g. residues 3-412 are 61% similar to CT605; and residues 22-349 are 33% similar to YBBC_BACSU.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 22-349 are 33% similar to a defined domain of YBBC_BACSU, defined as: HYPOTHETICAL 46.0 KD PROTEIN IN FEUA 5'REGION PRECURSOR (ORF2). HYPOTHETICAL PROTEIN; SIGNAL.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 23 to 409 (E-value = 4.9e-233) place CPn0776 in the DUF1343 family which is described as Protein of unknown function (DUF1343) (PF07075)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21

PDB Hit:


Gene Protein Sequence:
MKKIFYSFVLLSCIFPYVGCAQVFVGLDRIFSEGEYTRCIQGKKIALISH
SAAINSRGQDALSVFYSRKHDCTVEILCTLEHGYYGATPTETVGNQPSRY
PNLRSVSLYGVKEVPKEVAEHCDVFVYDVQDIGVRSYSFVTVLMQIVKAS
ERYGKQLIVLDRPNPMGGRIVDGPLPNPTTSGSLAIPYCYGMTPGELALF
FKKTYAPNANVVVIPMKGWNRSMTFDETGLIWMPTSPQMPDPQSPFFYAA
TGILGALSVASIGVGYTLPFKVLGAPWMDGEKVADELNRMKLPGVLFLPF
FYEPFFGKYKMEMCSGVLLVLQDPKIFYPVETQCTIWGVLKALYPKQVEQ
TLKSIERIPARRSSICNLFGGDEFLSISHKERYIVWPLRRLCKESRESFH
QLRSSCLLSEYAES$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAAAATTTTTTACTCTTTTGTATTGTTAAGTTGTATTTTCCCTTA
CGTAGGGTGTGCTCAAGTTTTTGTAGGCTTAGATCGTATTTTTTCTGAAG
GGGAGTATACACGTTGCATTCAAGGCAAGAAAATCGCTCTAATTTCTCAT
AGCGCAGCTATCAATAGTCGTGGGCAGGATGCCCTCTCTGTATTCTATTC
TCGTAAGCATGATTGTACCGTGGAAATCCTCTGTACGTTGGAACACGGCT
ATTATGGAGCCACACCTACAGAAACGGTGGGGAATCAGCCATCCAGATAT
CCAAATTTACGTTCTGTATCCTTGTATGGAGTGAAAGAGGTTCCCAAAGA
GGTTGCCGAACATTGTGATGTATTTGTTTATGATGTTCAGGATATCGGAG
TGCGTTCTTATAGCTTTGTTACCGTGCTGATGCAAATAGTAAAGGCTTCT
GAACGGTACGGAAAACAGCTCATTGTTTTAGATCGGCCGAATCCTATGGG
AGGAAGGATTGTTGATGGACCTCTTCCTAATCCCACAACTTCAGGTTCCC
TAGCGATTCCTTATTGTTATGGCATGACACCTGGGGAATTAGCGTTGTTT
TTTAAAAAGACATACGCTCCTAACGCTAATGTTGTCGTGATCCCTATGAA
AGGGTGGAATCGCTCGATGACCTTTGATGAAACAGGATTGATTTGGATGC
CCACAAGTCCTCAAATGCCAGATCCACAATCACCGTTTTTCTATGCTGCC
ACAGGGATTTTAGGTGCCTTGTCTGTAGCAAGTATCGGTGTAGGTTATAC
CTTACCTTTCAAAGTGCTCGGAGCTCCTTGGATGGACGGGGAAAAAGTTG
CCGACGAGCTGAATCGCATGAAGCTTCCCGGTGTTCTGTTTCTTCCTTTT
TTCTATGAGCCTTTTTTCGGAAAATACAAAATGGAGATGTGCTCCGGGGT
TCTTCTTGTTCTTCAAGATCCTAAGATTTTCTATCCAGTAGAAACACAAT
GTACAATTTGGGGTGTATTAAAAGCATTATATCCTAAACAGGTTGAGCAA
ACGTTAAAATCCATAGAGCGCATTCCTGCACGTCGATCTTCCATATGCAA
TTTATTTGGGGGGGATGAATTTCTCAGCATATCGCACAAAGAGCGCTATA
TTGTATGGCCATTGCGTAGGTTATGTAAAGAGTCTCGAGAGAGCTTTCAT
CAACTGCGTAGTTCATGTTTACTCTCAGAGTATGCAGAATCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy