Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR612 IGR611 IGR613 IGR617 IGR615 IGR614 IGR616 CPn0779 CPn0780 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0779 CPn0780 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0780 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 CPn0779 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0774 CPn0774
* Calculated from Protein Sequence

Gene ID: CPn0775

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
874031

Gene Stop:
873411

Gene Length:
621

Molecular Weight*:
23048

pI*:
7.20

Net Charge*:
0.73

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible YggV related protein (yggV).

Blast Summary:  PSI-Blast Search
Cpn0775 is orthologously related to CT606: residues 1-203 of CPn0775 are 64% similar to residues 1-203 of CT606, a predicted conserved hypothetical protein from C. trachomatis.
CPn0775 is also similar to TP0438, a predicted conserved hypothetical protein (basic) from T. pallidum.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0127
COG name: Xanthosine triphosphate pyrophosphatase, HAM1/YggV family
Functional Class:  F
The phylogenetic pattern of COG0127 is amtkyqvcebrh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 194 (E-value = 4.7e-50) place CPn0775 in the Ham1p_like family which is described as Ham1 family (PF01725)

PDB Hit:


Gene Protein Sequence:
MKIVIASSHGYKIRETKTFLKRLGDFDIFSLSDFPDYKLPQEQGDSITAN
ALTKGIHAANHLGCWVIADDTMLRVPALNGLPGPLSANFAGVGAYDKDHR
KKLLDLMSSLESLVDRSAYFECCVVLVSPNQEIFKTYGICEGYISHQEKG
SSGFGYDPIFVKYDYKQTFAELSEDVKNQVSHRAKALQKLAPHLQSLFEK
HLLTRD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTGTGATTGCTAGTTCTCATGGTTATAAAATACGAGAAACCAA
GACTTTTTTAAAGCGTTTAGGTGATTTCGATATTTTTTCTCTTTCTGATT
TTCCTGACTATAAACTTCCCCAAGAACAGGGAGATTCTATAACGGCGAAC
GCCCTTACTAAAGGGATTCACGCTGCCAATCATTTGGGTTGCTGGGTCAT
TGCGGATGATACGATGTTACGCGTCCCCGCTTTAAATGGTCTTCCGGGTC
CTTTATCTGCGAACTTTGCTGGTGTAGGTGCGTATGATAAAGATCATCGA
AAAAAGCTGCTTGATCTTATGTCGTCTTTGGAAAGCCTCGTAGACCGTTC
TGCGTACTTCGAGTGTTGTGTAGTTTTAGTCTCCCCTAATCAGGAGATTT
TTAAAACGTATGGGATATGCGAGGGCTACATCAGCCATCAAGAAAAAGGT
TCTTCAGGGTTCGGCTACGACCCTATCTTTGTAAAATATGATTACAAACA
AACATTTGCCGAGCTTAGTGAAGATGTGAAAAATCAAGTTTCTCACAGAG
CAAAGGCATTGCAAAAACTCGCCCCTCACCTGCAAAGCTTATTTGAAAAA
CACCTACTCACTAGGGACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy