Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR612 IGR611 IGR613 IGR615 IGR614 IGR616 IGR610 CPn0779 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0779 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0779 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0774 CPn0774
* Calculated from Protein Sequence

Gene ID: CPn0774

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
873195

Gene Stop:
873428

Gene Length:
234

Molecular Weight*:
8489

pI*:
4.80

Net Charge*:
-2.87

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT606.1. Residues 1-77 are 57% similar to CT606.1.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
42  
77

PDB Hit:


Gene Protein Sequence:
MNEGIHSVCFQKTPRLTAKSVVSMEMLLTTQQLPSAEGMPSVANLEADFL
RAEALLAEMREIRGCLEQSLRTLVPSE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGAAGGTATCCACTCTGTCTGTTTTCAAAAAACACCTCGGCTTAC
TGCGAAGTCCGTAGTGAGTATGGAGATGCTCTTAACTACTCAACAGCTTC
CTTCCGCAGAAGGGATGCCCTCGGTTGCTAATTTGGAAGCGGATTTTTTA
CGAGCAGAAGCTCTGTTAGCAGAAATGCGAGAAATTCGTGGTTGCTTGGA
GCAATCTTTGCGAACACTAGTCCCTAGTGAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy