Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_4 IGR612 IGR611 IGR613 IGR615 IGR614 IGR616 IGR610 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 tsa, - CPn0778 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0774 CPn0774
* Calculated from Protein Sequence

Gene ID: CPn0773

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ung  

Definition:
Uracil-DNA N-glycosylase

Gene Start:
872488

Gene Stop:
873198

Gene Length:
711

Molecular Weight*:
26991

pI*:
8.90

Net Charge*:
7.16

EC:
3.2.2.-  

Functional Class:
DNA metabolism  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
The sequence of uracil-DNA glycosylase
(monomer)is extremely well conserved in bacteria
and eukaryotes as well as in herpes viruses. The
enzyme removes unwanted uracil from DNA
(misincorporated dUTP).

From Prosite PDOC00121:

Uracil-DNA glycosylase (EC 3.2.2.-) (UNG) is a
DNA repair enzyme that excises uracil residues
from DNA by cleaving the N-glycosylic bond.
Uracil in DNA can arise as a result of
misincorportation of dUMP residues by DNA
polymerase or deamination of cytosine.

The sequence of uracil-DNA glycosylase is
extremely well conserved in bacteria and
eukaryotes as well as in herpes viruses. More
distantly related uracil-DNA glycosylases are
also found in poxviruses.

In eukaryotic cells, UNG activity is found in
both the nucleus and the mitochondria. Human
UNG1 protein is transported to both the
mitochondria and the nucleus. The N-terminal 77
amino acids of UNG1 seem to be required for
mitochondrial localization, but the presence of
a mitochondrial transit peptide has not been
directly demonstrated.

Blast Summary:  PSI-Blast Search
CPn0773 is similar to UU548 in U. urealyticulm and
MG097 in M. genitalium, both are predicted uracil-DNA glycosylases.

CPn0773 is orthologously related to CT607:
residues 15-235 are 77% similar to residues
8-228 of CT607.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0692
COG name: Uracil DNA glycosylase
Functional Class:  L
The phylogenetic pattern of COG0692 is ----y---ebrhujgpo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 64 to 224 (E-value = 1.2e-70) place CPn0773 in the UDG family which is described as Uracil DNA glycosylase superfamily (PF03167)

PDB Hit:


Gene Protein Sequence:
MQNATIDQLPVSWQEQLPLCWREQLKEEWSKPYMQQLLIFLKQEYKEHTV
YPEENCVFSALRSTPFDQVRVVILGQDPYPGKGQAHGLSFSVPEGQRLPP
SLINIFRELKTDLGIENHKGCLQSWANQGILLLNTVLTVRAGEPFSHAGK
GWELFTDAIVTKLIQERTHIIFVLWGAAARKKCELLFNSKHQHAVLSSPH
PSPLAAHRGFFGCSHFSKINYLLNKLNKPMINWKLP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGAATGCTACTATAGATCAGCTCCCTGTGTCTTGGCAAGAACAGCT
TCCTTTATGTTGGCGTGAGCAACTTAAGGAAGAGTGGTCCAAACCCTACA
TGCAGCAACTTCTTATTTTTTTAAAACAGGAGTATAAAGAGCATACTGTT
TACCCTGAGGAGAATTGCGTATTTTCTGCTTTGAGAAGCACGCCCTTTGA
TCAGGTGCGTGTTGTTATCTTGGGTCAAGATCCTTATCCAGGAAAGGGGC
AAGCTCATGGATTGAGCTTTAGTGTTCCCGAAGGTCAGCGTTTGCCCCCT
TCTTTAATTAATATTTTCCGAGAGTTAAAAACAGATTTGGGGATTGAAAA
TCATAAGGGGTGTTTGCAGTCTTGGGCAAACCAAGGGATCTTATTATTGA
ACACAGTATTGACGGTGCGTGCGGGAGAACCCTTCTCTCATGCTGGTAAA
GGTTGGGAGCTGTTTACAGATGCCATTGTGACGAAACTGATTCAAGAGAG
AACCCATATCATCTTTGTTTTATGGGGAGCTGCTGCAAGAAAAAAATGCG
AGCTTTTATTTAATTCAAAACATCAACATGCGGTTCTATCCTCTCCTCAC
CCCTCTCCGTTAGCTGCTCACCGTGGTTTTTTTGGTTGTTCACACTTTTC
AAAAATTAACTATCTCCTTAATAAGCTGAATAAACCAATGATTAATTGGA
AGCTCCCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy