Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR612 IGR611 IGR613 IGR615 IGR614 IGR610 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 topA, - CPn0769 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 topA, - CPn0769 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0775 rpoN, - CPn0771 uvrD, - CPn0772 topA, - CPn0769 ung, - CPn0773 CPn0770 CPn0776 groEL, - CPn0777 CPn0774 CPn0774
* Calculated from Protein Sequence

Gene ID: CPn0772

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
uvrD  

Definition:
ATP dependent DNA helicase

Gene Start:
872385

Gene Stop:
870466

Gene Length:
1920

Molecular Weight*:
73199

pI*:
7.20

Net Charge*:
1.10

EC:
3.6.1.-  

Functional Class:
DNA metabolism  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthes

Comment:
In E.Coli this helicase is also involved in post-incision events of nucleotide excision repair and methyl directed mismatch repair.

Blast Summary:  PSI-Blast Search
CPn0772 is similar to TP0102 and TP1028 in T. pallidum, UU501 in U. urealyticum and MG244 in M. genitalium. They are all predicted DNA helicase II.

CPn0772 is orthologously related to CT608, a predicted ATP-dependent DNA helicase:residues 5-632 are 62% similar to residues 4-628 of CT608.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0210
COG name: Superfamily I DNA and RNA helicases
Functional Class:  L
The phylogenetic pattern of COG0210 is --T-YqvCEBRHUJgPOLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 7 to 487 (E-value = 1.3e-220) place CPn0772 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
488  
518

PDB Hit:


Gene Protein Sequence:
MTCISELNEAQRKAVTAPLNPVLVLAGAGAGKTRVVTYRILHLINQGIAP
REILAVTFTNKAARELKERIVNQCASTNEFDVPMVCTFHSLGVFILRRSI
NLLNRENNFTIYDQSDAEKLIKHALQQHNLKPNLASKIQAHVSQAKNRLL
FPEDLDPNDYIDPVVSIYQEYQKKLIEANALDFDDLLFLTVRLLRESPEA
QELYNQLWKALLIDEYQDTNHAQYTLMQLLSKQHRNVFAVGDPDQSIYSW
RGANIHNILNFENDYPNAKVLCLEENYRSYGNILNAANALIKNNASRLEK
ELRSVKGPGEKIRLFLGSTDREEADFVAAEILQLHRVGNIKLRDICIFYR
TNSQSRTFEDALLRRRIPYEIIGGLSFYKRKEIQDILAFLRIFISKSDIV
AFDRTVNLPKRGIGSTTIFALTQYAIAQGLPILKACQQALDTKDVKLSKK
QQEGLQEYLALFPQIEHAYNTLSLRDFIESVVRITGYLEILKEDADTFKD
RKSNLEELYHKALESEQQNPKTHLELFLDDLALKGSDDDLNLTADRVNLM
TLHNGKGLEFRVSFLVGLEEQLLPHANSLGGTYENIEEERRLCYVGITRA
QDLLYLTAAQVRSLWGTVRMMKPSRFLKEIPKDYMIQVR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACATGTATCTCAGAACTTAACGAAGCACAACGCAAAGCTGTAACAGC
TCCTCTCAATCCTGTACTCGTTCTAGCAGGAGCAGGAGCAGGTAAAACTC
GTGTGGTTACCTATAGAATCTTACACCTAATTAACCAAGGCATCGCGCCT
CGAGAAATTCTGGCTGTAACTTTTACGAATAAAGCAGCGCGAGAACTTAA
AGAACGTATTGTCAATCAGTGTGCTTCCACTAATGAATTTGATGTTCCGA
TGGTGTGTACATTTCATAGTTTAGGAGTTTTTATTCTCCGACGTTCTATA
AATCTGCTAAATCGTGAAAATAATTTTACTATTTATGATCAAAGTGACGC
GGAAAAGCTCATCAAGCATGCCTTGCAACAACACAACCTCAAACCTAATC
TTGCGAGCAAAATACAAGCTCACGTCTCACAAGCAAAGAACCGTTTACTC
TTTCCCGAAGACTTGGATCCCAATGACTATATCGATCCTGTAGTCTCGAT
ATACCAAGAATACCAAAAGAAACTTATCGAAGCGAATGCTCTGGATTTCG
ATGATCTTCTCTTTTTAACCGTAAGACTTCTTAGAGAAAGTCCCGAAGCA
CAGGAATTATATAACCAATTATGGAAAGCATTGCTCATCGATGAGTATCA
AGATACCAACCATGCACAATATACTTTAATGCAGCTCCTCTCAAAGCAAC
ATCGCAATGTCTTTGCTGTTGGGGATCCTGATCAGTCTATCTACTCCTGG
CGAGGAGCAAATATTCACAATATCTTAAATTTTGAAAACGATTACCCTAA
TGCTAAAGTCTTATGCCTCGAAGAAAACTACCGCAGTTATGGCAATATTC
TAAATGCCGCTAATGCTCTGATTAAAAATAACGCATCAAGGTTAGAAAAA
GAATTGCGTAGCGTCAAAGGACCTGGAGAAAAGATTCGTCTTTTCCTAGG
AAGCACAGATCGCGAAGAAGCAGACTTTGTCGCTGCAGAAATTCTTCAAT
TACATAGAGTCGGGAATATAAAACTACGTGACATCTGTATTTTCTATAGA
ACGAACTCCCAATCTCGGACATTTGAAGACGCTCTACTTCGCAGGCGCAT
TCCCTATGAAATTATCGGGGGTCTCTCCTTCTACAAGCGTAAGGAAATCC
AAGATATCCTAGCCTTTCTCCGTATCTTTATTTCCAAAAGCGACATCGTT
GCTTTTGATAGAACTGTAAATCTACCCAAACGAGGGATCGGTTCAACAAC
GATATTTGCACTCACGCAATATGCAATTGCTCAAGGTCTCCCTATCCTCA
AAGCATGCCAACAAGCCTTGGATACTAAAGACGTCAAATTATCTAAAAAA
CAACAAGAAGGCCTTCAAGAGTATCTTGCACTTTTCCCTCAAATTGAACA
TGCCTACAATACTCTTTCCCTTAGAGATTTTATAGAGTCTGTAGTTAGGA
TCACGGGTTACCTTGAGATCTTAAAAGAAGATGCGGATACCTTCAAAGAT
CGGAAAAGCAATTTAGAGGAACTCTATCATAAAGCTTTGGAATCCGAACA
ACAAAATCCAAAGACACATTTGGAACTTTTCCTTGATGATCTTGCCTTAA
AAGGCTCTGATGATGATCTAAATTTAACTGCGGATCGCGTGAATTTGATG
ACCCTTCATAATGGAAAAGGGTTGGAGTTCCGTGTATCATTTCTTGTAGG
TCTAGAAGAACAATTGCTTCCACATGCGAACTCTCTGGGCGGCACTTATG
AAAATATTGAAGAAGAACGACGGTTATGCTACGTAGGAATTACTCGAGCT
CAAGATCTCCTCTATCTTACTGCCGCACAAGTTCGCAGCCTCTGGGGAAC
CGTACGGATGATGAAGCCCAGTAGATTTTTAAAGGAAATTCCAAAAGATT
ATATGATTCAAGTGCGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy