Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR612 IGR611 IGR609 IGR613 IGR610 CPn0775 rpoN, - CPn0771 CPn0766 uvrD, - CPn0772 topA, - CPn0769 ung, - CPn0773 CPn0770 CPn0768 CPn0775 rpoN, - CPn0771 CPn0766 uvrD, - CPn0772 topA, - CPn0769 ung, - CPn0773 CPn0770 CPn0768 CPn0775 rpoN, - CPn0771 CPn0766 uvrD, - CPn0772 topA, - CPn0769 ung, - CPn0773 CPn0770 CPn0768 CPn0774 CPn0767 CPn0774 CPn0767
* Calculated from Protein Sequence

Gene ID: CPn0770

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
868340

Gene Stop:
869134

Gene Length:
795

Molecular Weight*:
31007

pI*:
8.60

Net Charge*:
3.36

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT642, a hypothetical protein sequence. Residues 4-263 are 57% similar to CT642.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
166  
190

PDB Hit:


Gene Protein Sequence:
VEKLEFVTSLSSPDDDLITFNKQGLIAGPEEEKVAFLVRSNAMLDAGPET
PASFPESLREQFDIFPEYVEVLYSNEGLDVWEAGCTWILNNEVTIQLRKH
HRKASRWLGMYSRDEVLAHEAVHAVRMKFHEPVFEEVLAYQTSRWGWRRF
FGPLFRSPGESYLLLFFTILGLGISLWYPAGILIMLVLPMYFLMRLCMAQ
SYLYRAMKKIRKMLGVPPLWVLLRLTDKEIKMFAKEPIPVLEHYARKRKL
ENVRWKQIYQSYFV$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAAAACTTGAGTTTGTCACCAGCCTTTCTTCTCCTGATGATGATTT
GATTACTTTCAATAAACAGGGATTGATTGCAGGCCCAGAAGAAGAAAAGG
TAGCGTTTCTTGTACGTAGCAATGCTATGCTAGATGCAGGACCCGAAACC
CCCGCGTCGTTTCCTGAATCTTTAAGGGAACAATTCGATATTTTCCCTGA
GTATGTTGAAGTGCTCTACTCTAATGAAGGATTAGATGTCTGGGAAGCAG
GATGTACGTGGATTCTAAATAATGAAGTGACCATCCAACTGCGTAAACAT
CACCGGAAAGCTTCGCGATGGCTAGGAATGTATTCCAGAGATGAGGTACT
CGCTCACGAAGCCGTGCATGCTGTGAGAATGAAATTTCATGAGCCTGTCT
TTGAAGAGGTGTTAGCTTATCAAACTTCTCGTTGGGGTTGGAGAAGGTTT
TTCGGTCCTCTATTTCGCTCTCCAGGAGAGAGCTACTTGCTATTATTCTT
CACCATTTTAGGTTTAGGAATCTCCTTATGGTATCCTGCCGGTATACTGA
TTATGCTGGTTTTACCTATGTATTTTTTGATGCGATTGTGCATGGCGCAG
AGCTATTTGTATCGGGCCATGAAAAAGATTCGTAAAATGCTCGGAGTACC
TCCCTTATGGGTGCTGCTAAGGCTGACGGATAAGGAAATAAAAATGTTTG
CTAAAGAGCCTATTCCTGTTTTGGAACACTATGCTAGAAAACGAAAGCTT
GAAAATGTCCGTTGGAAGCAAATTTATCAATCCTACTTTGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy