Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR612 IGR611 IGR608 IGR609 IGR610 CPn0764 rpoN, - CPn0771 CPn0766 uvrD, - CPn0772 topA, - CPn0769 CPn0770 CPn0768 CPn0764 rpoN, - CPn0771 CPn0766 uvrD, - CPn0772 topA, - CPn0769 CPn0770 CPn0768 rpoN, - CPn0771 CPn0766 uvrD, - CPn0772 topA, - CPn0769 CPn0765 CPn0764 CPn0765 CPn0770 CPn0768 CPn0767 CPn0767
* Calculated from Protein Sequence

Gene ID: CPn0769

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
topA  

Definition:
DNA topoisomerase I

Gene Start:
867733

Gene Stop:
865118

Gene Length:
2616

Molecular Weight*:
98887

pI*:
8.60

Net Charge*:
13.59

EC:
5.99.1.2  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
rom Prosite PDOC00333:

DNA topoisomerase I (EC 5.99.1.2) is one of
the two types of enzyme that catalyze the
interconversion of topological DNA isomers.
Type I topoisomerases act by catalyzing the
transient breakage of DNA, one strand at a
time, and the subsequent rejoining of the
strands. When a prokaryotic type I
topoisomerase breaks a DNA backbone bond, it
simultaneously forms a protein-DNA link where
the hydroxyl group of a tyrosine residue is
joined to a 5'-phosphate on DNA, at one end
of the enzyme-severed DNA strand.

Prokaryotic organisms, such as Escherichia
coli, have two type I topoisomerase isozymes:
topoisomerase I (gene topA) and topoisomerase
III (gene topB). So far the only
non-prokaryotic members of this family have
been found in yeast and in human: TOP3, which
are evolutionary related to prokaryotic
topoisomerase III.

Blast Summary:  PSI-Blast Search
CPn0769 is similar to TP0394 in T. pallidum, MG122 in M. genitalium and UU590 in U. urealyticum. They are all predicted DNA topoisomerase I.

CPn0769 is orthologously related to CT643: residues 1-861 are 70% similar to residues 1-855 of CT643.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0550
COG name: Topoisomerase IA
Functional Class:  L
The phylogenetic pattern of COG0550 is amtkyqvcEBrHUJgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0769 is similar to CPn0577, a predicted SWIB complex protein: residues 792-861 are 49% similar to residues 17-87 of CPn0577.

Pfam Summary:  Pfam Search
Residues 3 to 110 (E-value = 3.7e-35) place CPn0769 in the Toprim family which is described as Toprim domain (PF01751)
Residues 124 to 555 (E-value = 5.4e-153) place CPn0769 in the Topoisom_bac family which is described as DNA topoisomerase (PF01131)
Residues 645 to 683 (E-value = 2.1e-13) place CPn0769 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)
Residues 692 to 733 (E-value = 3.2e-05) place CPn0769 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)
Residues 785 to 860 (E-value = 3.6e-33) place CPn0769 in the SWIB family which is described as SWIB/MDM2 domain (PF02201)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
130  
187
non-globular  
663  
813

PDB Hit:


Gene Protein Sequence:
MKKSLIIVESPAKIKTLQKLLGSEFVFASSIGHIVDLPAKEFGIDVDHDF
EPQYQVLPDKQEVINHIRKLAAKCEKVYLSPDPDREGEAIAWHIANQLPD
SPLIQRVSFNAITKNAVTEALKHPRTIDMALVNAQQARRLLDRIVGYKIS
PILSRKLQQRSGISAGRVQSVALKLVVDREKAIDAFVPVEYWNLRVLMQD
PKTTKTFWAHLYAVQGKKWEKEIPEGKTENDVLLINSEEKARHYAELLEK
SSYTITRVEAKAKRRFAPPPFITSTLQQEASRHFRFSASRTMSIAQTLYE
GVDLDSEDSTGLITYMRTDSVRVDPEALTTVREYIQQTFGKEYLPEKANV
YTTKKMTQDAHEAIRPTDINLTPDKLKNKLSDDQFKVYNLIWKRFVASQI
TPAIYDTLAVQITTDTEIDLRASGSLLKFKGFLAVYEEKQDDENDQEEDH
PLPPLHAQDALIKEEVSQEQAFTKPLPRFTEASLVKELEKSGIGRPSTYA
TIMNKIQSREYTTKENQRLRPTELGKIISQFLETNFPRIMDIGFTALMED
ELELIADNKKPWKLLLQEFWTTFLPVVITAEKEAVIPRILTNIECSKCHK
GKLVKIWSKNSYFYGCSEYPECDYRTSEEELAFNKEDYAEDTPWDSPCPL
CGGVMKVRHGRYGTFLGCEKYPECRGTISIHKKGEEIEQEEPIPCPAIGC
NGKIFKKRSRYNKIFYSCSEYPECSVIGNSIDAVITKYSGTEKIPYKKKT
PTKKKSSAKTTKAAKTPSKKGKAKSSVKKSSEKKTGPLFLPSPDLAKMIG
NEPVSRGEATKKIWDYIKEHQLQAPENKKLLVPDNNLATIIGPNPIDMFQ
LSKHLSQHLTKVSNDESSASS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAGTCCTTAATTATAGTAGAATCACCTGCAAAAATTAAAACGCT
ACAAAAATTATTAGGGAGTGAATTTGTTTTTGCCTCATCTATAGGACATA
TTGTAGATCTCCCTGCTAAGGAATTTGGCATTGATGTGGATCATGATTTC
GAACCACAATACCAAGTGCTTCCCGATAAACAAGAGGTCATCAATCACAT
CCGCAAGCTAGCCGCGAAGTGTGAAAAAGTCTATCTTTCCCCTGACCCTG
ATAGAGAAGGAGAGGCAATTGCCTGGCACATCGCGAATCAGCTTCCTGAC
TCTCCTCTGATCCAGAGGGTATCGTTTAATGCCATTACCAAAAATGCGGT
TACAGAGGCCTTAAAACACCCTCGAACCATCGATATGGCTTTAGTCAACG
CACAACAAGCGCGGAGACTTCTTGACCGCATTGTGGGATATAAAATTTCT
CCTATCCTAAGTCGAAAGTTACAACAACGCTCAGGGATATCTGCAGGGCG
TGTGCAATCTGTAGCTTTGAAGCTTGTCGTAGATCGAGAAAAGGCTATTG
ATGCTTTTGTTCCTGTTGAATACTGGAATTTACGCGTTTTAATGCAAGAT
CCCAAAACGACAAAAACGTTTTGGGCGCATTTATACGCTGTGCAAGGAAA
AAAGTGGGAGAAAGAAATCCCTGAAGGGAAAACCGAAAATGATGTCCTTC
TTATTAACTCTGAAGAGAAAGCCCGTCACTATGCCGAGCTGTTAGAGAAA
TCCTCGTATACAATCACTCGTGTAGAAGCTAAGGCAAAACGACGTTTTGC
TCCTCCTCCTTTCATTACATCCACTCTCCAGCAGGAAGCAAGCCGGCATT
TTCGTTTTTCTGCTTCTAGAACCATGTCTATAGCGCAAACCCTCTATGAG
GGCGTCGATTTAGATAGTGAAGATTCTACAGGTTTGATTACCTACATGCG
TACGGATTCCGTACGTGTAGATCCCGAAGCATTAACTACAGTTAGAGAGT
ACATCCAACAGACTTTCGGTAAAGAATATCTCCCTGAGAAAGCAAACGTA
TATACTACAAAAAAGATGACGCAAGATGCTCACGAAGCCATACGTCCCAC
TGATATTAATCTGACTCCTGACAAATTAAAGAATAAGCTTTCTGATGATC
AATTTAAAGTATACAACTTAATCTGGAAACGCTTCGTAGCCTCACAGATT
ACCCCTGCAATTTATGATACTTTAGCTGTTCAAATTACTACGGATACAGA
AATAGACCTCCGAGCTTCAGGATCCTTACTAAAATTTAAAGGGTTTCTCG
CTGTCTATGAAGAGAAGCAAGATGATGAAAATGATCAAGAAGAAGACCAT
CCTCTCCCCCCCCTACATGCCCAAGATGCCTTAATCAAAGAGGAAGTATC
CCAAGAACAGGCATTTACAAAACCCCTTCCTAGATTCACAGAAGCTTCTC
TAGTCAAAGAGTTAGAAAAATCTGGGATCGGCCGTCCTTCAACGTATGCC
ACGATAATGAACAAAATTCAAAGTCGTGAATATACGACTAAAGAAAATCA
ACGGTTACGTCCTACAGAATTAGGAAAGATTATCTCACAGTTCTTAGAAA
CAAACTTTCCAAGAATTATGGATATCGGGTTCACAGCTCTCATGGAAGAC
GAGCTTGAACTCATTGCAGATAATAAAAAACCTTGGAAACTCTTACTTCA
AGAATTCTGGACTACATTCCTTCCTGTAGTGATTACAGCAGAAAAAGAAG
CTGTCATTCCTAGAATTCTCACAAATATAGAATGTTCTAAGTGCCATAAA
GGAAAACTAGTAAAAATCTGGTCTAAAAACAGTTATTTCTATGGCTGCTC
AGAATATCCTGAATGCGATTACCGCACTTCTGAAGAAGAGCTCGCTTTCA
ACAAAGAAGACTATGCTGAAGACACCCCCTGGGACAGTCCTTGTCCTCTT
TGTGGAGGCGTTATGAAAGTACGTCACGGCCGCTATGGAACATTTTTAGG
GTGTGAGAAGTATCCTGAATGCCGTGGCACTATATCAATCCATAAAAAGG
GAGAGGAAATCGAACAGGAAGAGCCTATCCCCTGCCCTGCAATAGGCTGT
AATGGGAAAATTTTCAAAAAACGCTCCCGTTACAACAAGATTTTCTATTC
CTGTTCAGAGTATCCTGAATGTAGTGTGATTGGAAATTCTATAGATGCTG
TAATCACAAAGTACTCAGGAACAGAAAAAATTCCCTATAAGAAAAAAACT
CCGACCAAGAAAAAATCTTCAGCAAAAACAACAAAAGCAGCCAAAACACC
TTCTAAAAAGGGAAAAGCAAAAAGCTCGGTTAAAAAATCTTCAGAAAAGA
AAACAGGTCCTTTATTCCTTCCCTCTCCAGATCTAGCAAAAATGATCGGA
AACGAACCCGTATCTCGGGGAGAAGCAACCAAAAAAATCTGGGATTACAT
CAAGGAACATCAATTACAGGCACCAGAAAATAAAAAACTTTTAGTTCCTG
ATAACAATTTAGCTACGATCATTGGTCCGAATCCTATCGATATGTTCCAA
CTTTCGAAACACCTAAGTCAGCATTTAACAAAGGTCTCTAATGACGAGTC
GTCGGCTTCTTCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy