Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR611 IGR608 IGR607 IGR609 IGR606 IGR610 ygfA, - CPn0763 CPn0764 rpoN, - CPn0771 CPn0766 topA, - CPn0769 CPn0770 CPn0768 ygfA, - CPn0763 CPn0764 rpoN, - CPn0771 CPn0766 topA, - CPn0769 CPn0770 CPn0768 ygfA, - CPn0763 CPn0764 rpoN, - CPn0771 CPn0766 topA, - CPn0769 CPn0765 CPn0765 CPn0770 CPn0768 CPn0767 CPn0767
* Calculated from Protein Sequence

Gene ID: CPn0768

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (probable NifR3-like protein)

Gene Start:
864159

Gene Stop:
865166

Gene Length:
1008

Molecular Weight*:
36933

pI*:
6.90

Net Charge*:
-0.16

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
This protein is thought to belong to the UPF0034 family (NIFR3/SMM1) (nir3)(yohI).

Blast Summary:  PSI-Blast Search
CPn0768 is orthologously related to CT644: residues 1-323 of CPn0768 are 71% similar to residues 1-324 of CT644, a predicted conserved hypothetical protein (probable NifR3-like protein) from C. trachomatis.
CPn768 is also similar to TP0980, a predicted conserved hypothetical protein/ possible transcriptional regulator from T. pallidum.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0042
COG name: Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family
Functional Class:  R
The phylogenetic pattern of COG0042 is amt-YqvCEBrHuj--Olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 17 to 329 (E-value = 1.8e-72) place CPn0768 in the Dus family which is described as Dihydrouridine synthase (Dus) (PF01207)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
71  
170

PDB Hit:


Gene Protein Sequence:
MAAPIFIKNILLRSSIVYAPLAGFSDYPYRCMSALYQPGLMFCEMVKVEG
ILYAPERTSKLLDYNENMRPIGAQLCGSNPETSGEAAKILEGLGFDLIDL
NCGCPTDKITKDGSGSGLLKTPELIGRILDKIINSVSIPVTVKIRSGWDM
EHINVEDTVRIIRDAGASAVFVHGRTRAQGYHGPSKQEYISRAKAAAGKE
FPVFGNGDIFSPEAAQAMLTTGCDGVLVARGTLGAPWIGKQIQDYLTTGS
YEKIPFIKRKAAFLEHMRLVEDYYQSETKFLSETRKLCGHYLISAAKVRF
LRSSLAKATSYQEVYQLVNDYEEADDSSLETFVKC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGCTCCAATATTTATAAAAAATATTTTACTTCGTTCCTCTATAGT
CTATGCTCCTCTAGCGGGATTTTCAGATTATCCCTACCGTTGCATGTCCG
CATTGTATCAACCAGGGTTGATGTTTTGTGAAATGGTGAAAGTAGAAGGG
ATACTCTACGCTCCTGAGCGTACTTCGAAGCTTCTAGATTATAATGAGAA
CATGCGTCCCATAGGAGCGCAGTTGTGCGGTAGTAATCCAGAAACTAGTG
GGGAGGCCGCTAAAATTTTAGAAGGCCTTGGTTTCGACCTTATAGACCTA
AATTGTGGATGTCCTACAGATAAAATCACCAAAGATGGCAGTGGGTCAGG
TCTTTTGAAGACGCCAGAGCTTATTGGGAGGATTTTAGATAAAATCATCA
ATAGCGTTTCCATTCCTGTAACAGTAAAAATTCGCTCGGGTTGGGATATG
GAACATATCAACGTAGAGGATACGGTACGTATTATACGTGATGCTGGAGC
TAGCGCAGTTTTTGTTCACGGGAGAACTCGTGCTCAGGGATACCACGGTC
CTAGCAAGCAAGAGTATATTTCTAGAGCCAAGGCTGCTGCAGGAAAAGAA
TTCCCAGTTTTTGGTAACGGAGATATTTTTTCTCCAGAAGCTGCGCAAGC
AATGCTAACTACAGGATGTGATGGTGTTCTGGTAGCTCGAGGAACCTTGG
GAGCCCCTTGGATTGGAAAACAAATCCAAGACTATCTCACTACAGGAAGC
TATGAGAAAATTCCCTTTATCAAAAGGAAAGCTGCGTTTCTGGAGCATAT
GCGCCTAGTAGAAGACTATTATCAAAGCGAAACGAAGTTCCTTTCAGAAA
CACGTAAATTATGTGGCCACTACCTAATTTCCGCGGCTAAGGTGCGTTTT
CTTCGTTCGTCTCTAGCAAAAGCGACATCCTACCAAGAAGTCTACCAGCT
TGTGAATGATTACGAAGAAGCCGACGACTCGTCATTAGAGACCTTTGTTA
AATGCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy