Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR608 IGR607 IGR609 IGR606 IGR610 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0770 CPn0768 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0770 CPn0768 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0765 CPn0765 CPn0770 CPn0768 CPn0767 CPn0767
* Calculated from Protein Sequence

Gene ID: CPn0767

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
863884

Gene Stop:
864180

Gene Length:
297

Molecular Weight*:
11560

pI*:
10.20

Net Charge*:
5.07

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0767 is orthologously related to CT645: residues 1-98 of CPn0767 are 65% similar to residues 1-98 of CT645, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0762
COG name: Predicted integral membrane protein, YggT family
Functional Class:  S
The phylogenetic pattern of COG0762 is ------vCeb-huj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 80 (E-value = 5.2e-32) place CPn0767 in the YGGT family which is described as YGGT family (PF02325)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
9  
26
transmembrane  
65  
89

PDB Hit:


Gene Protein Sequence:
MLSYLLRTAINVYSFLILAYIFASWVPDCQSARWYQLVSKCVDPFLNFFR
RFVPRIGFIDPSPFVGLLCLGILPFVILRVLRFIILNIFHSPWLLQYL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTATCTTATTTGTTAAGAACGGCTATTAATGTTTATAGCTTTCTAAT
TTTAGCCTATATCTTTGCTTCTTGGGTCCCTGATTGCCAGTCTGCGCGCT
GGTACCAGTTGGTTTCCAAGTGTGTTGACCCTTTTTTGAATTTCTTTCGT
CGCTTTGTTCCTAGAATTGGATTTATAGATCCCAGTCCTTTTGTTGGTCT
GCTTTGCCTTGGAATCCTTCCTTTTGTTATATTAAGAGTCCTACGTTTTA
TTATTCTTAATATTTTTCATTCTCCATGGCTGCTCCAATATTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy