Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR604 IGR608 IGR607 IGR609 IGR605 IGR606 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0761 CPn0760 CPn0768 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0761 CPn0760 CPn0768 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0765 CPn0765 CPn0760 CPn0768 CPn0767 CPn0767 CPn0761
* Calculated from Protein Sequence

Gene ID: CPn0765

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
862382

Gene Stop:
861798

Gene Length:
585

Molecular Weight*:
22672

pI*:
8.80

Net Charge*:
4.30

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0765 is similar to CT647: residues 4-194 of CPn0765 are 30% similar to residues 7-192 of CT647, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23
non-globular  
24  
120

PDB Hit:


Gene Protein Sequence:
MKKWISILILSFLSLLSILPVLAITINHVKISQRWSDLNSQILTLKVIRD
HEDQVIKHNARISKDRNNLSIESLNASCKQLRPLSKERERLNKLNSNSLL
AQSKEVWERKRALEKSNHQLVWNCEQMHNDFAFVRLEQATEMDNEDIESL
FSLFNPENPVAPLVFFTCWKMTKQTTPLGNEVWLTHAEAISRWI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATGGATTTCTATTTTAATTCTTAGTTTTCTTTCTCTTTTGAG
TATACTTCCCGTCCTAGCGATTACCATAAATCACGTGAAGATCTCTCAGC
GTTGGTCTGATCTAAATTCTCAGATTCTCACACTGAAAGTTATAAGAGAT
CATGAAGATCAGGTGATCAAACACAATGCTCGCATTTCTAAGGATCGCAA
TAACCTCTCAATAGAAAGTTTAAATGCCTCTTGCAAGCAATTACGCCCTC
TATCCAAAGAACGCGAACGTTTAAACAAATTAAACTCAAATTCTTTGCTA
GCACAAAGTAAAGAAGTTTGGGAAAGAAAGCGTGCTCTAGAAAAATCAAA
TCACCAGCTCGTCTGGAACTGCGAACAAATGCACAATGACTTTGCATTTG
TGCGTCTAGAGCAAGCTACTGAAATGGATAATGAAGATATCGAGTCCTTG
TTTTCTCTTTTCAACCCAGAGAACCCTGTCGCGCCCCTAGTTTTCTTCAC
CTGTTGGAAAATGACAAAACAAACTACGCCTCTAGGAAATGAGGTCTGGT
TAACACATGCTGAGGCTATAAGTCGATGGATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy