Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR604 IGR608 IGR607 IGR603 IGR609 IGR605 IGR606 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0761 CPn0760 CPn0768 folP, - CPn0758 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0761 CPn0760 CPn0768 folP, - CPn0758 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0765 CPn0765 CPn0761 CPn0768 CPn0767 folA, - CPn0759 CPn0760 folP, - CPn0758 CPn0767 folA, - CPn0759
* Calculated from Protein Sequence

Gene ID: CPn0764

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
861807

Gene Stop:
860521

Gene Length:
1287

Molecular Weight*:
48811

pI*:
7.50

Net Charge*:
2.54

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0764 is orthologously related to CT648: residues 26-428 of CPn0764 are 64% similar to residues 23-424 of CT648, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
17

PDB Hit:


Gene Protein Sequence:
MDIKKLFCLFLCSSLIAMSPIYGKTGDYEKLTLTGINIIDRNGLSETICS
KEKLKKYTKVDFLAPQPYQKVMRMYKNKRGDNVSCLTAYHTNGQIKQYLE
CLNNRAYGRYREWHVNGNIKIQAEVIGGIADLHPSAESGWLFDQTTFAYN
DEGILEAAIVYEKGLLEGSSVYYHTNGNIWKECPYHKGVPQGKFLTYTSS
GKLLKEQNYQQGKRHGLSIRYSEDSEEDVLAWEEYHEGRLLKAEYLDPQT
HEIYATIHEGNGIQAIYGKYAVIETRAFYRGEPYGKVTRFDNSGTQIVQT
YNLLQGAKHGEEFFFYPETGKPKLLLNWHEGILNGIVKTWYPGGTLESCK
ELVNNKKSGLLTIYYPEGQIMATEEYDNDLLIKGEYFRPGDRHPYSKIDR
GCGTAVFFSSAGTITKKIPYQDGKPLLN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATATAAAAAAACTCTTTTGCTTATTTCTATGTTCTTCTCTAATTGC
CATGAGTCCCATTTATGGGAAAACAGGTGACTATGAGAAACTCACCCTTA
CAGGGATCAATATCATTGATAGAAACGGCCTGTCAGAAACTATTTGCTCT
AAAGAGAAGCTAAAGAAATACACCAAGGTAGACTTTCTTGCTCCCCAGCC
CTATCAAAAGGTCATGAGGATGTATAAAAACAAACGCGGAGATAACGTTT
CTTGTTTAACAGCCTATCACACTAACGGGCAAATTAAGCAGTACCTGGAG
TGTCTCAATAATCGTGCTTATGGAAGATATCGTGAATGGCACGTCAACGG
GAATATCAAAATCCAAGCTGAGGTTATCGGAGGTATTGCGGATCTTCATC
CCTCAGCAGAGTCTGGCTGGCTATTTGATCAAACTACATTTGCCTATAAT
GATGAAGGTATCTTAGAAGCCGCTATCGTCTATGAAAAAGGGCTGCTCGA
AGGATCTTCGGTGTATTACCATACTAATGGGAATATTTGGAAAGAGTGTC
CCTATCATAAGGGAGTTCCTCAAGGTAAATTCCTGACATACACATCTTCG
GGGAAACTGCTCAAAGAACAGAATTACCAACAAGGCAAAAGACACGGTCT
TTCGATTCGCTACAGCGAAGATTCCGAAGAAGATGTTTTAGCCTGGGAAG
AATATCATGAGGGACGACTCCTAAAAGCAGAGTACTTAGATCCTCAAACT
CACGAAATCTATGCGACTATACACGAAGGGAACGGCATTCAAGCAATCTA
CGGCAAGTATGCCGTTATAGAAACTAGGGCATTTTACCGAGGGGAACCTT
ATGGAAAAGTTACCAGATTCGACAACTCCGGAACACAGATTGTCCAAACG
TATAACCTTTTGCAAGGCGCGAAGCACGGAGAAGAATTTTTCTTTTATCC
TGAGACAGGGAAACCCAAGCTGCTTCTTAATTGGCATGAAGGAATTTTAA
ATGGGATAGTAAAAACTTGGTATCCCGGAGGAACCTTAGAAAGTTGTAAA
GAACTCGTAAATAACAAAAAATCCGGGTTACTGACCATTTACTACCCTGA
AGGACAGATCATGGCGACCGAAGAGTATGATAATGATCTTCTAATTAAAG
GAGAGTACTTCCGCCCTGGAGACCGTCATCCCTACTCTAAAATAGATCGT
GGTTGTGGGACTGCAGTATTTTTCTCGTCGGCGGGAACTATTACTAAAAA
AATCCCCTATCAGGACGGCAAACCTTTGCTCAACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy