Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR604 IGR608 IGR607 IGR603 IGR609 IGR605 IGR606 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0761 CPn0760 CPn0768 folP, - CPn0758 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0761 CPn0760 CPn0768 folP, - CPn0758 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 topA, - CPn0769 CPn0765 CPn0765 CPn0761 CPn0768 folP, - CPn0758 CPn0767 folA, - CPn0759 folA, - CPn0759 CPn0760 CPn0767
* Calculated from Protein Sequence

Gene ID: CPn0763

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ygfA  

Definition:
predicted formyltetrahydrofolate cycloligase ygfA

Gene Start:
860511

Gene Stop:
859969

Gene Length:
543

Molecular Weight*:
20553

pI*:
7.20

Net Charge*:
0.54

EC:
6.3.3.2  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; folate  

Pathway: pathway table
One carbon pool by folate

Comment:
This enzyme is a ligase that adds ATP and 5-formyltetrahydrofolate to form
5,10-methenyltetrahydrofolate.

Blast Summary:  PSI-Blast Search
CPn0763 is orthologous to CT649, a predicted 5-formyltetrahydrofolate cyclo-ligase:
residues 7-179 are 37% similar to CT649. CPn0763 is weakly similar to TP0694 and MG245.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0212
COG name: 5-formyltetrahydrofolate cyclo-ligase
Functional Class: H
The phylogenetic pattern of COG0212 is --t-yq-cebrhujgp-linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 180 (E-value = 4.9e-69) place CPn0763 in the 5-FTHF_cyc-lig family which is described as 5-formyltetrahydrofolate cyclo-ligase family (PF01812)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
53

PDB Hit:


Gene Protein Sequence:
MTDPKIEKSALRKLFISIRRDLSEERKHEASSAVASFVRSFSKESVVLSF
VSFNHEIDMQEANRILIQKCTLALPKIDQENLYPVLIPSIDDLISVVHPK
DPFSKQTPISSDKITHVLVPGLAFDQQGYRLGYGHGFYDRWLAQHPYPSI
RTIGIGYCEQKIDRLPQESHDIPLSQIYLC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGATCCTAAAATAGAGAAATCCGCACTACGTAAACTATTTATCTC
TATACGCAGGGATCTCTCTGAAGAACGCAAGCATGAGGCCTCTTCTGCAG
TGGCCTCTTTCGTTCGCAGCTTTTCTAAAGAGAGCGTCGTTCTCTCTTTT
GTCTCTTTCAATCACGAAATAGACATGCAAGAAGCAAATCGCATACTTAT
CCAGAAATGTACCCTAGCTCTTCCCAAGATTGATCAGGAAAACCTCTATC
CTGTTCTTATCCCCTCGATAGACGATCTTATTTCCGTTGTGCATCCCAAA
GATCCCTTCTCGAAACAAACACCGATCTCGAGTGATAAGATTACCCACGT
GCTCGTTCCGGGCCTTGCCTTTGATCAGCAGGGCTATCGGCTTGGTTATG
GTCACGGTTTCTACGATCGCTGGTTAGCACAACATCCCTATCCCTCTATA
CGAACCATCGGCATCGGCTACTGCGAACAAAAAATCGATAGACTTCCCCA
AGAAAGTCATGACATCCCCCTTTCCCAAATCTATTTATGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy