Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR604 IGR608 IGR607 IGR603 IGR602 IGR609 IGR605 IGR606 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 CPn0767 CPn0761 CPn0760 folP, - CPn0758 rpoD, - CPn0756 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 CPn0767 CPn0761 CPn0760 folP, - CPn0758 rpoD, - CPn0756 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 CPn0765 CPn0765 CPn0767 CPn0761 folP, - CPn0758 rpoD, - CPn0756 folX, - CPn0757 folA, - CPn0759 folX, - CPn0757 folA, - CPn0759 CPn0760
* Calculated from Protein Sequence

Gene ID: CPn0762

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recA  

Definition:
RecA protein

Gene Start:
859597

Gene Stop:
858536

Gene Length:
1062

Molecular Weight*:
38215

pI*:
7.20

Net Charge*:
0.57

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
See Hintz et al., FEMS Microbiol. Lett. 127:175
(1995); Zhang et al., Infect. Immun. 63:676
(1995).
The recA protein has many functions for which
ATP-dependence is required.

From Prosite PDOC00131:

The bacterial recA protein is essential for
homologous recombination and recombinational
repair of DNA damage. RecA has many activities:
it filaments, it binds to single- and
double-stranded DNA, it binds and hydrolyzes
ATP, it is also a recombinase and, finally, it
interacts with lexA causing its activation and
leading to its autocatalytic cleavage.

RecA is a protein of about 350 amino-acid
residues. Its sequence is very well conserved
among eubacterial species. It is also found in
the chloroplast of plants.

Blast Summary:  PSI-Blast Search
CPn0762 is similar to TP0692 in T. pallidum, MG339 in M. genitalium and UU084 in U. urealyticum. They are all predicted RecA proteins.

CPn0762 is orthologously related to CT650 and they share 87% similarity.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0468
COG name: RecA/RadA recombinase
Functional Class:  L
The phylogenetic pattern of COG0468 is AMTKYqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 331 (E-value = 3.5e-209) place CPn0762 in the RecA family which is described as recA bacterial DNA recombination protein (PF00154)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
88  
163

PDB Hit:


Gene Protein Sequence:
MNLPDRKKALEAAVAYIEKQFGAGSIMSLGRHSATHEISTIKTGALSLDL
ALGIHGVPKGRVIEIFGPESSGKTTLATHIVANAQKMGGVAAYIDAEHAL
DPSYASLIGVNIDDLMISQPDCGEDALSIAELLARSGAVDVIVIDSVAAL
VPKSELEGDIGDVHVGLQARMMSQALRKLTATLSRSQTCAVFINQIREKI
GVSFGNPETTTGGRALKFYSSIRLDIRRIGSIKGSDNSDIGNRIKVKVAK
NKLAPPFRIAEFDILFNEGISSAGCILDLAVEYNIIEKKGSWFNYQEKKL
GQGREFVREELKRNRKLFEEIEKRIYDVIAANKTPSVHANETPQEVPAQT
VEA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTACCTGATAGAAAAAAGGCTCTAGAAGCTGCTGTTGCTTATAT
TGAAAAGCAATTCGGCGCTGGGTCCATCATGAGTTTAGGAAGACACTCTG
CCACACATGAAATCTCCACCATCAAAACAGGAGCTTTATCTTTAGACTTA
GCTCTTGGAATTCATGGGGTCCCCAAAGGACGGGTGATCGAAATCTTTGG
TCCTGAATCCTCAGGGAAAACGACACTAGCTACCCATATTGTCGCGAATG
CTCAAAAAATGGGCGGTGTTGCTGCCTATATAGATGCTGAACATGCTTTA
GATCCTAGTTATGCATCTCTTATTGGCGTCAATATCGATGATCTTATGAT
TTCTCAACCCGACTGTGGTGAAGATGCATTAAGCATAGCAGAATTGCTCG
CGCGTTCAGGAGCTGTCGATGTTATCGTTATTGACTCTGTAGCCGCTTTA
GTTCCTAAAAGCGAACTCGAAGGAGACATCGGTGATGTACACGTAGGCCT
ACAAGCTCGTATGATGTCTCAAGCATTACGCAAGCTCACCGCTACCCTAT
CACGTAGCCAAACCTGTGCAGTGTTCATTAACCAAATCCGAGAGAAAATC
GGTGTTAGCTTCGGAAACCCAGAAACTACTACGGGAGGACGTGCCTTAAA
ATTCTACTCTTCAATACGATTAGATATTCGCCGTATAGGTTCAATAAAAG
GCAGTGATAACTCTGACATCGGAAATCGAATTAAAGTGAAGGTAGCTAAA
AATAAACTTGCTCCTCCATTCAGAATCGCAGAATTTGACATCCTATTCAA
TGAAGGGATTTCTTCTGCAGGTTGTATCCTAGATCTTGCTGTCGAATATA
ATATTATTGAGAAAAAAGGTTCTTGGTTCAACTATCAAGAGAAGAAGTTA
GGACAGGGAAGAGAATTTGTTCGTGAAGAACTTAAACGTAATAGAAAGCT
TTTTGAGGAAATTGAGAAGCGCATCTACGATGTAATTGCAGCGAATAAAA
CTCCCTCTGTTCATGCTAATGAAACACCTCAGGAAGTTCCTGCTCAAACA
GTAGAAGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy