Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR604 IGR608 IGR607 IGR603 IGR602 IGR605 IGR606 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 CPn0761 CPn0760 folP, - CPn0758 rpoD, - CPn0756 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0766 CPn0761 CPn0760 folP, - CPn0758 rpoD, - CPn0756 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0765 CPn0766 CPn0765 CPn0761 folP, - CPn0758 rpoD, - CPn0756 folX, - CPn0757 folA, - CPn0759 folX, - CPn0757 folA, - CPn0759 CPn0760
* Calculated from Protein Sequence

Gene ID: CPn0761

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
857704

Gene Stop:
858378

Gene Length:
675

Molecular Weight*:
25957

pI*:
4.90

Net Charge*:
-11.34

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0761 is orthologously related to CT610: residues 3-223 of CPn0761 are 57% similar to residues 7-227 of CT610, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 224 (E-value = 1.6e-126) place CPn0761 in the PQQC family which is described as Coenzyme PQQ synthesis protein C (PQQC) (PF05312)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
54  
81

PDB Hit:


Gene Protein Sequence:
MTSWIELLDKQIEDQHMLKHEFYQRWSEGKLEKQQLQAYAKDYYLHIKAF
PCYLSALHARCDDLQIRRQILENLMDEEAGNPNHIDLWRQFALSLGVSEE
ELANHEFSQAAQDMVATFRRLCDMPQLAVGLGALYTYEIQIPQVCVEKIR
GLKEYFGVSARGYAYFTVHQEADIKHASEEKEMLQTLVGRENPDAVLQGS
QEVLDTLWNFLSSFINSTEPCSCK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACATCCTGGATAGAATTACTTGATAAGCAAATTGAAGATCAACATAT
GTTAAAGCACGAATTTTATCAGCGTTGGTCTGAAGGAAAGTTAGAAAAAC
AACAACTTCAAGCTTATGCCAAAGATTACTATTTACATATTAAAGCATTT
CCTTGTTACCTTTCAGCGCTGCATGCTCGCTGTGATGACTTGCAGATTCG
TAGACAAATTCTTGAGAATCTCATGGATGAAGAAGCTGGAAATCCTAATC
ACATAGATTTATGGAGACAGTTTGCTTTATCTCTTGGAGTTTCTGAAGAG
GAGCTTGCCAATCATGAATTCAGTCAGGCTGCTCAAGATATGGTAGCGAC
ATTTCGCCGCTTATGCGACATGCCACAACTTGCCGTGGGTTTAGGCGCTC
TCTATACTTATGAGATTCAGATTCCTCAAGTCTGTGTAGAGAAAATCCGT
GGTTTGAAAGAATATTTTGGAGTTTCTGCTCGAGGCTATGCATACTTTAC
TGTACATCAAGAAGCTGATATTAAACATGCCAGCGAAGAGAAAGAAATGC
TACAAACTTTGGTAGGCAGAGAGAATCCTGATGCTGTTTTGCAAGGATCA
CAAGAAGTTTTAGATACTCTATGGAACTTTTTGAGCTCTTTTATTAATTC
AACGGAGCCTTGTTCTTGTAAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy