Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR604 IGR607 IGR603 IGR602 IGR605 IGR601 IGR606 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0761 CPn0760 CPn0755 folP, - CPn0758 rpoD, - CPn0756 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0761 CPn0760 CPn0755 folP, - CPn0758 rpoD, - CPn0756 ygfA, - CPn0763 recA, - CPn0762 CPn0764 CPn0765 CPn0765 CPn0761 CPn0755 folP, - CPn0758 rpoD, - CPn0756 folX, - CPn0757 folA, - CPn0759 folX, - CPn0757 folA, - CPn0759 CPn0760
* Calculated from Protein Sequence

Gene ID: CPn0760

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
856957

Gene Stop:
857697

Gene Length:
741

Molecular Weight*:
27394

pI*:
4.60

Net Charge*:
-11.26

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0760 is orthologously related to CT611: residues 1-239 of CPn0760 are 61% similar to residues 1-238 of CT611, a predicted conserved hypothetical protein from C. trachomatis. CPn0760 is also similar to a couple hypothetical proteins: residues 27-202 are 30% similar to Methanococcus jannaschii (H64395) and residues 21-203 are 29% similar to Methanobacterium thermoautotrophicum (AE000874).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1478
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG1478 is amt-------r-------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 231 (E-value = 1.3e-69) place CPn0760 in the DUF129 family which is described as Protein of unknown function DUF129 (PF01996)

PDB Hit:


Gene Protein Sequence:
MKITTVKTPKIYPYDDLYSILESSLPKLNERSIVVITSKIVSLCEGAVVE
LEKVSKDELIKQEADAYVFVEKYGIYLTKKWGILIPSAGIDESNVEGYFV
LYPRDFLLSVNTLGDWLRNFYHLEHCGIIISDSHTTPLRRGTMGLGLCWN
GFFPLYNYVGKPDCFGRALKMTYSNLLDGLSAAAVLCMGEGDEQTPIAII
EEAPKITFHSSPTTLQDMSTLAIAEDEDLYGPLLQSMAWETPAPTS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATCACCACAGTCAAAACACCAAAAATATATCCTTATGATGACCT
ATATTCTATTCTAGAGTCTTCATTGCCTAAGTTAAACGAACGCTCTATTG
TTGTGATTACGTCTAAGATAGTCTCTTTATGTGAAGGTGCTGTTGTAGAA
CTTGAGAAGGTTTCTAAAGATGAATTAATAAAGCAAGAAGCAGATGCCTA
TGTTTTTGTAGAGAAATACGGCATATATCTAACTAAGAAGTGGGGGATAC
TCATTCCTTCAGCGGGGATTGACGAGTCCAATGTTGAAGGTTATTTTGTG
TTGTATCCTAGGGATTTTTTGCTTTCCGTGAATACTCTAGGGGATTGGTT
AAGGAATTTCTATCATCTCGAGCATTGCGGAATCATTATATCGGATAGTC
ATACGACTCCGTTGCGTCGGGGAACTATGGGTTTAGGCTTATGTTGGAAT
GGTTTTTTCCCTTTATATAATTATGTAGGAAAACCAGATTGTTTTGGTCG
TGCTTTGAAGATGACTTATAGCAATTTATTAGATGGTTTATCGGCAGCTG
CGGTTCTTTGTATGGGAGAGGGAGACGAGCAGACTCCCATTGCTATTATA
GAGGAAGCTCCCAAGATTACCTTCCATTCTTCTCCAACTACATTACAAGA
TATGAGCACTTTAGCAATCGCTGAGGATGAAGATTTATATGGTCCTCTGC
TACAATCTATGGCATGGGAAACTCCCGCACCAACCTCCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy