Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR604 IGR603 IGR599 IGR602 IGR598 IGR605 IGR601 IGR600 IGR606 rs20, - CPn0754 CPn0753 recA, - CPn0762 CPn0761 CPn0760 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 rs20, - CPn0754 CPn0753 recA, - CPn0762 CPn0761 CPn0760 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 rs20, - CPn0754 CPn0753 recA, - CPn0762 CPn0761 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 folX, - CPn0757 folA, - CPn0759 folX, - CPn0757 folA, - CPn0759 CPn0760
* Calculated from Protein Sequence

Gene ID: CPn0757

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
folX  

Definition:
probable dihydroneopterin aldolase (DHNA)

Gene Start:
854733

Gene Stop:
855137

Gene Length:
405

Molecular Weight*:
15104

pI*:
4.90

Net Charge*:
-4.76

EC:
4.1.2.25  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; folate  

Pathway: pathway table
Folate biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
CPn0757 is orthologously related to CT614, a predicted dihydroneopterin aldolase (DHNA):
residues 7-126 are 49% similar to CT614. No similarity to T.pallidum, M.genitalium,
or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1539
COG name: Dihydroneopterin aldolase
Functional Class:  H
The phylogenetic pattern of COG1539 is ----y--cEbrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 9 to 124 (E-value = 1e-46) place CPn0757 in the FolB family which is described as Dihydroneopterin aldolase (PF02152)

PDB Hit:


Gene Protein Sequence:
VIAIERYQLIISKFRMWLFLGCSVEERHFKQPVLISVTFSYNEVPSACLS
DKLSDACCYLEVTSLIEEIANTKPYALIEHLANELFDSLVISFGDKASKI
DLEVEKERPPVPNLLNPIKFTISKELCPSPVLSA$

Gene Nucleotide Sequence:  Sequence Viewer
GTGATTGCTATAGAACGTTATCAGTTAATTATATCCAAGTTTCGTATGTG
GTTGTTTTTAGGGTGTTCTGTTGAAGAGCGTCATTTTAAGCAGCCTGTTC
TTATTTCAGTGACTTTTTCTTATAACGAAGTCCCGTCTGCTTGTTTATCC
GACAAGCTTTCAGATGCTTGTTGTTATCTAGAGGTCACCTCTCTTATTGA
AGAGATTGCGAATACAAAGCCTTATGCTTTAATAGAGCACCTGGCTAACG
AGCTATTTGATAGCTTAGTGATATCTTTTGGAGATAAAGCCTCCAAGATA
GATCTAGAGGTAGAAAAAGAACGGCCACCTGTTCCCAACCTATTAAATCC
TATAAAATTTACAATTAGTAAAGAGCTATGTCCGAGCCCCGTTTTGTCTG
CTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy