Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR603 IGR599 IGR602 IGR598 IGR601 IGR597 IGR600 rs20, - CPn0754 CPn0753 CPn0760 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 rs20, - CPn0754 CPn0753 CPn0760 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 rs20, - CPn0754 CPn0753 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 folX, - CPn0757 folA, - CPn0759 folX, - CPn0757 CPn0760 folA, - CPn0759
* Calculated from Protein Sequence

Gene ID: CPn0755

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
851597

Gene Stop:
852802

Gene Length:
1206

Molecular Weight*:
46474

pI*:
8.30

Net Charge*:
7.01

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0755 is orthologously related to CT616: residues 8-393 of CPn0755 are 53% similar to residues 32-417 of CT616, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0419
COG name: ATPase involved in DNA repair
Functional Class:  L
The phylogenetic pattern of COG0419 is amtkyqvceb------ol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
17  
36
transmembrane  
41  
58
coil-coil  
70  
121
coil-coil  
143  
191
coil-coil  
203  
230

PDB Hit:


Gene Protein Sequence:
MLLVRKWLHTCFKYWIYFLPVVTLLLPLVCYPFLSISQKIYGYFVFTTIS
SLGWFFALRRRENQLKTAAVQLLQTKIRKLTENNEGLRQIRESLKEHQQE
SAQLQIQSQKLKNSLFHLQGLLVKTKGEGQKLETLLLHRTEENRCLKMQV
DSLIQECGEKTEEVQTLNRELAETLAYQQALNDEYQATFSEQRNMLDKRQ
IYIGKLENKVQDLMYEIRNLLQLESDIAENIPSQESNAVTGNISLQLSSE
LKKIAFKAENIEAASSLTASRYLHTDTSVHNYSLECRQLFDSLREENLGM
LFVYARQSQRAVFANALFKTWTGYCAEDFLKFGSDIVISGGKQWMEDLHS
SREECSGRLVIKTKSRGHLPFRYCLMALNKGPLCYHVLGVLYPLHKEVLQ
S$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTATTGGTAAGGAAATGGTTGCATACTTGTTTCAAATATTGGATTTA
CTTTCTTCCGGTGGTAACGCTACTTCTTCCCCTAGTGTGTTACCCTTTTC
TGTCGATTAGTCAAAAAATTTATGGATACTTTGTTTTTACTACAATTTCT
TCTTTAGGCTGGTTTTTTGCATTGAGACGTAGGGAAAATCAATTAAAAAC
AGCAGCTGTTCAGCTTCTTCAAACAAAAATTAGAAAATTAACAGAAAATA
ATGAAGGGTTAAGACAAATTCGAGAATCTCTTAAAGAACATCAGCAAGAG
AGTGCTCAACTGCAAATTCAAAGTCAGAAGCTTAAAAACAGCCTATTTCA
TCTTCAGGGTTTACTTGTGAAAACTAAGGGAGAGGGGCAAAAATTAGAAA
CTTTGTTACTTCATAGAACAGAAGAGAATCGATGTTTGAAAATGCAAGTA
GATTCTTTAATTCAGGAATGCGGAGAAAAAACAGAGGAAGTACAAACTTT
AAATCGAGAGTTGGCTGAGACTTTAGCCTACCAGCAAGCTTTAAATGACG
AGTATCAAGCGACCTTCTCTGAGCAACGCAATATGCTGGATAAGCGGCAG
ATCTACATTGGAAAGCTGGAAAACAAGGTTCAGGATTTAATGTATGAGAT
CCGTAACTTGCTTCAGTTAGAGTCAGACATAGCAGAGAATATTCCTTCTC
AAGAATCGAATGCTGTTACGGGAAATATTTCTTTACAATTGTCTAGTGAG
TTAAAAAAAATTGCTTTTAAGGCTGAAAACATAGAGGCAGCCTCTTCTTT
AACAGCATCACGTTACCTTCATACAGATACGAGTGTGCATAACTACTCTT
TAGAGTGTCGCCAGTTATTTGATAGCTTAAGAGAAGAAAATCTCGGGATG
CTTTTTGTCTATGCTCGTCAATCCCAACGTGCGGTTTTTGCTAATGCGTT
ATTTAAAACGTGGACGGGGTATTGTGCAGAAGATTTTTTAAAATTTGGTA
GTGACATAGTGATTTCTGGGGGCAAACAGTGGATGGAGGATCTTCATTCC
TCTAGAGAAGAATGCTCTGGTAGATTAGTGATTAAAACGAAATCACGAGG
TCATCTTCCTTTCCGTTATTGTTTAATGGCTTTGAATAAAGGCCCTCTTT
GCTATCATGTTTTGGGGGTTCTTTATCCTCTCCATAAAGAAGTGCTTCAG
AGTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy