Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR599 IGR602 IGR598 IGR601 IGR597 IGR596 IGR600 rs20, - CPn0754 tctD, - CPn0750 CPn0753 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 rs20, - CPn0754 tctD, - CPn0750 CPn0753 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 rs20, - CPn0754 tctD, - CPn0750 CPn0753 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 folX, - CPn0757 folX, - CPn0757
* Calculated from Protein Sequence

Gene ID: CPn0754

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs20  

Definition:
30S ribosomal protein S20

Gene Start:
851336

Gene Stop:
851037

Gene Length:
300

Molecular Weight*:
11131

pI*:
11.60

Net Charge*:
19.22

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembl

Comment:


Blast Summary:  PSI-Blast Search
CPn0754 shows weak similarity to MG363 in M.
genitalium and UU310 in U. urealyticum.

CPn0754 is orthologously related to CT617:
residues 1-91 are 57% similar to that of CT617.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0268
COG name: Ribosomal protein S20
Functional Class:  J
The phylogenetic pattern of COG0268 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 17 to 96 (E-value = 9.5e-21) place CPn0754 in the Ribosomal_S20p family which is described as Ribosomal protein S20 (PF01649)

PDB Hit:


Gene Protein Sequence:
MAPKKPNKKNVIQRRPSAEKRILTAQKRELINHSFKSKVKTIVKKFEASL
KLDDTQATLSNLQSVYSVVDKAVKRGIFKDNKAARIKSKATLKVNARAS$


Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACCTAAAAAACCGAATAAAAAAAACGTTATACAAAGAAGACCTTC
TGCTGAAAAACGCATTCTAACTGCTCAAAAAAGAGAGTTAATCAATCACA
GCTTCAAATCTAAAGTGAAAACAATAGTCAAAAAGTTTGAAGCATCTTTA
AAACTCGACGACACTCAAGCCACTCTTAGCAACTTACAATCCGTCTACAG
TGTTGTAGATAAGGCTGTAAAGCGAGGTATCTTCAAAGATAATAAGGCAG
CACGCATTAAATCTAAAGCAACCTTAAAAGTTAACGCGAGAGCATCGTGA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy