Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR599 IGR602 IGR598 IGR595 IGR601 IGR597 IGR596 IGR600 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 rs20, - CPn0754 tctD, - CPn0750 CPn0753 glmU, - CPn0749 CPn0755 folP, - CPn0758 recD, - CPn0752 rpoD, - CPn0756 CPn0751 folX, - CPn0757 folX, - CPn0757
* Calculated from Protein Sequence

Gene ID: CPn0753

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
851006

Gene Stop:
850158

Gene Length:
849

Molecular Weight*:
29997

pI*:
8.30

Net Charge*:
5.59

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
None.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
174  
191
transmembrane  
227  
244
transmembrane  
249  
270

PDB Hit:


Gene Protein Sequence:
MATAHLGRQALLHLRSWTPAIRASGNLFRQQSMSLHNNVLFAGDIVGAIK
NSTAISRHALGSSHYAHAALQKTEGFLGAADGVNTAVAGAMLWGQLLNGS
MIFETDEETGELRRCNEADAEGCMTQKLQRRSALTITGKVARLASKTLGT
ATFLHEMDVVSLGANANKIGCKVTSCLNLVATGCSLTESSISLYRILSTR
PETISDPENRNKPSAEFAARSKAIRNAFIAWLGDVVDLVCDALGTLSLFL
PAILGVHAVLIMAILGLISCVINFVKDYAKIG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAACAGCACATCTTGGTAGACAAGCACTTCTGCATTTAAGATCTTG
GACTCCGGCAATCAGAGCTTCAGGCAATTTATTCAGACAGCAATCAATGT
CTCTACACAATAACGTTTTGTTTGCCGGCGACATCGTCGGAGCAATTAAA
AATTCCACAGCAATCTCTAGACATGCTTTAGGAAGCTCCCATTATGCACA
TGCTGCTTTGCAGAAAACTGAAGGGTTTCTGGGTGCCGCTGACGGAGTGA
ACACTGCAGTGGCAGGAGCTATGTTGTGGGGCCAACTACTTAATGGTTCT
ATGATCTTCGAAACTGATGAGGAAACAGGAGAACTCAGACGTTGCAACGA
AGCAGATGCTGAGGGTTGTATGACTCAAAAACTACAACGACGATCAGCCC
TAACTATCACAGGAAAAGTTGCTCGTTTAGCATCAAAGACTCTTGGAACA
GCTACATTCTTACATGAAATGGACGTGGTTTCCTTAGGAGCCAATGCAAA
CAAAATTGGATGTAAGGTGACTTCCTGCCTAAACTTAGTGGCTACAGGAT
GCTCTTTAACTGAGAGTTCAATTTCACTTTACAGAATTTTAAGCACCAGG
CCTGAAACAATCTCCGACCCCGAAAACAGAAACAAGCCTTCTGCCGAATT
CGCAGCACGTTCCAAAGCTATAAGAAACGCCTTCATTGCATGGCTTGGAG
ATGTAGTTGATTTAGTTTGTGATGCTCTTGGCACTCTTTCTCTATTCCTT
CCTGCTATTCTTGGAGTCCATGCTGTTCTAATTATGGCTATTCTTGGATT
GATTAGCTGTGTCATAAACTTTGTTAAAGATTATGCTAAAATAGGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy