Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR594 IGR599 IGR598 IGR595 IGR601 IGR597 IGR596 IGR600 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 CPn0755 recD, - CPn0752 rpoD, - CPn0756 CPn0751 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 CPn0755 recD, - CPn0752 rpoD, - CPn0756 CPn0751 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 CPn0755 recD, - CPn0752 rpoD, - CPn0756 CPn0751
* Calculated from Protein Sequence

Gene ID: CPn0752

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recD  

Definition:
exonuclease V alpha subunit protein

Gene Start:
848604

Gene Stop:
850085

Gene Length:
1482

Molecular Weight*:
55822

pI*:
9.40

Net Charge*:
9.68

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidulm or U. urealyticum sequencs.

CPn0752 is orthologously related to CT652, a predicted exodeoxyribonuclease V alpha subunit: residues 9-490 are 47% similar to CT652. CPn0752 also shows weak similarity to CT033, a predicated exodeoxynuclease V alpha subunit.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0507
COG name: ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member
Functional Class:  L
The phylogenetic pattern of COG0507 is -m--Y---ebrh----o-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0752 is paralogously related to CPn0123, a predicted exodeoxyribonuclease V alpha subunit: residues 133-484 are 26% similar to CPn0123.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LHTEFAPFLEDLVHQQVISPLDIAFASKHISSDFEESFVFLAVSSALWRY
GHPFLSLEENRIRPSLGGISETDLYRGFHNLPKEARDKLFVVVSGRLYLR
SLYTIRSKLLDKLSLLCSATPNYFPPSIDSSILSEEQNFIFNKITQGCFS
IVSGGPGTGKTFLAAQLILSLVKQQPKLRIAIVSPTGKATSHIRQILMKY
NIFDDMVLMQTVHHFLQEYAYRRYNSIDVLLVDEGSMVTFDLLYSLVQTL
QGYEKDKKLYTSSLIILGDTNQLPPIGIGVGNPLQDLIGYFHENTFFLKT
SHRAKTGVVDQLTQSVLRGEMISFSPLPSISSAIEVLKNRFVKSLRQSEA
RLCVLTPMRHGPWGVLNLNTMIHQRLARSDPDLRIPIMVTSRYETWGLFN
GDTGLLCLKTQKLHFPQHEPIDSRALSQYVYNYVMSVHKSQGSEYDEVIV
IIPKGSEVFGVSILYTAITRAKYRVSVWGDPETLHKIIKKSNY$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCACACAGAATTTGCTCCTTTTTTAGAAGACTTAGTACATCAGCAGGT
GATATCCCCTTTAGACATCGCTTTTGCTTCTAAGCACATCTCTTCGGACT
TTGAAGAGTCTTTTGTTTTTCTCGCGGTCTCCTCAGCGCTTTGGCGTTAT
GGTCATCCTTTTCTTTCCCTTGAGGAAAATCGCATTAGACCTTCTCTAGG
AGGGATCTCAGAAACAGATTTGTATCGGGGATTTCATAACCTTCCTAAGG
AAGCTCGAGATAAATTATTTGTCGTTGTTTCAGGACGTTTGTATTTACGG
TCTCTGTATACGATACGATCGAAACTCTTAGACAAGCTTTCGTTGCTTTG
TTCAGCAACCCCGAATTATTTTCCTCCTTCTATAGATTCTTCGATCCTTT
CAGAAGAGCAAAACTTTATTTTTAATAAAATAACTCAAGGATGTTTTTCT
ATAGTTTCTGGAGGCCCAGGAACAGGAAAAACTTTTTTAGCTGCACAACT
CATCCTCTCTTTAGTGAAGCAGCAACCTAAGTTACGTATTGCTATAGTAT
CTCCTACAGGAAAGGCCACGTCTCATATTCGTCAGATTCTTATGAAATAT
AATATATTTGACGACATGGTGTTGATGCAGACGGTGCACCACTTTCTTCA
GGAGTATGCGTACCGTCGCTATAACTCTATAGATGTCCTTTTAGTAGATG
AAGGCTCTATGGTAACTTTTGACTTGTTGTATAGTTTGGTACAAACCCTA
CAGGGATATGAGAAAGACAAAAAACTTTATACCTCGAGTTTAATTATTCT
CGGAGATACCAATCAATTGCCTCCTATTGGCATTGGGGTTGGAAATCCCC
TTCAAGATCTCATAGGATATTTCCATGAAAATACGTTTTTCCTGAAGACA
TCGCATAGGGCAAAGACTGGAGTTGTGGATCAGCTGACTCAATCTGTATT
GCGTGGCGAAATGATTTCTTTTTCTCCTCTCCCATCGATATCCTCAGCTA
TAGAAGTCTTGAAAAATCGTTTTGTAAAGTCGTTACGTCAATCAGAAGCA
CGTTTGTGTGTATTGACTCCTATGCGCCATGGCCCTTGGGGGGTTCTGAA
CTTAAACACAATGATACATCAAAGATTGGCGAGAAGCGATCCTGATTTAC
GTATTCCTATTATGGTGACGAGTCGTTATGAAACTTGGGGACTATTTAAT
GGAGACACAGGATTACTGTGTTTAAAAACTCAGAAATTGCATTTCCCTCA
ACATGAACCCATAGATTCTAGGGCTCTATCACAATACGTCTACAATTACG
TTATGTCTGTACACAAGAGCCAGGGGAGTGAATACGATGAGGTTATTGTA
ATTATTCCCAAGGGAAGCGAAGTGTTTGGGGTGTCTATTCTCTATACTGC
AATTACCCGAGCTAAATATAGAGTTTCAGTTTGGGGAGATCCCGAGACGT
TACATAAGATAATTAAGAAGTCTAATTACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy