Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_2 IGR594 IGR599 IGR598 IGR595 IGR597 IGR596 IGR600 IGR593 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 CPn0755 recD, - CPn0752 CPn0746 CPn0751 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 CPn0755 recD, - CPn0752 CPn0746 CPn0751 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 CPn0755 recD, - CPn0752 CPn0746 CPn0751
* Calculated from Protein Sequence

Gene ID: CPn0751

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamhydia-specific hypothetical protein

Gene Start:
846608

Gene Stop:
848437

Gene Length:
1830

Molecular Weight*:
71162

pI*:
5.80

Net Charge*:
-14.64

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0751 is similar to CT651: residues 1-606 of CPn0751 are 34% similar to residues 1-602 of CT651, a predicted Chlamhydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MFRCILFGIFLLTCFSSGGVLYYLFCSHDFSIGPKEKSRSVWIEEEKEFT
DSVLHHLPSQHQHLHILCFQGFLLQKQQKFSQAEKIFSKVYDEAQDGPFL
FKEEILGSRLINSFFLEKTDVMETILCLLNQRCPNSPYYHLFKALVCYKQ
KLYREVIEQLAYWQEEKTRALAPLLNISIEQLLTDFLLDYISAHSLIEQK
MFPEGRVILNRNINRLLKHECEWNAKTYDRIAILLSRSYFLELVESKSAD
IYFDYYEMVLFYLKKIYILEQCPYAELLPEEELVSLIMEHVFILPKDKLY
PLIQLLEMWQKHYVHPNSSLVVQILVDRFSTHMEGAIRFCEALVSFSGLE
ELHQQIITTFEELLSNKVQQIKTEEAKQCVALLHILDPSISISEKLALSS
DTLQNIVSGDDEQHTKLRNYLDLWEAIQSYDIDRQQLVHHLVYGAKDLWK
KGGNDEKALNLLQLVLRFTSYDIECESVVFLFIKQAYKQALSSHAIARLL
KLEKFISEANIPSIVISEAEKANFLADAEYLFAHEDYDKCYLYSMWLTKV
APSPQSYRLAGLCLMENKRYDEALEFLCMLSPNDSINDYKTQKALAFCQK
HQSKDRAAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTCGTTGCATATTGTTTGGTATTTTCCTACTCACGTGTTTTTCTTC
TGGCGGGGTGTTATATTACTTATTCTGTTCCCATGATTTTTCTATAGGGC
CTAAGGAAAAATCACGATCCGTGTGGATTGAGGAAGAAAAAGAGTTCACG
GATTCCGTATTACATCATCTGCCATCGCAACATCAGCATTTGCATATTCT
TTGTTTCCAAGGGTTTTTACTACAGAAGCAACAAAAGTTTTCTCAAGCAG
AAAAGATTTTCTCTAAAGTTTACGACGAGGCTCAGGACGGTCCTTTTCTT
TTTAAGGAGGAAATTTTAGGATCCCGACTGATCAACAGTTTTTTTTTAGA
AAAAACAGACGTCATGGAGACCATTCTTTGTCTTCTGAATCAGCGCTGTC
CCAACTCCCCTTACTACCACTTATTTAAGGCTCTAGTATGCTATAAGCAA
AAGCTATACCGTGAGGTCATAGAGCAACTAGCCTACTGGCAAGAAGAGAA
AACTCGAGCGCTTGCTCCTTTATTGAATATAAGTATTGAACAGCTGCTAA
CAGATTTTCTGTTAGATTATATTTCTGCGCATTCTCTGATAGAACAGAAA
ATGTTCCCCGAAGGCAGAGTAATTCTTAATCGCAATATCAATAGGTTATT
AAAACACGAATGTGAGTGGAATGCGAAGACATACGATCGTATTGCGATTC
TTCTTAGCCGGAGTTATTTTCTAGAGTTGGTAGAATCTAAGTCTGCAGAT
ATTTATTTTGATTATTATGAGATGGTGCTTTTCTATCTCAAAAAGATCTA
TATTTTAGAGCAGTGTCCTTATGCAGAACTTCTCCCCGAGGAAGAGCTTG
TTTCCTTGATTATGGAACACGTGTTTATCCTTCCTAAAGATAAATTATAT
CCTTTAATTCAGCTCCTAGAGATGTGGCAGAAGCATTATGTTCACCCAAA
TAGTTCTTTAGTAGTTCAGATATTGGTAGACCGCTTTTCTACACATATGG
AAGGGGCTATTCGGTTTTGTGAGGCTTTAGTTTCTTTCTCTGGATTGGAA
GAATTACATCAGCAAATTATTACCACTTTTGAAGAGCTGCTTTCAAATAA
AGTACAGCAGATAAAAACTGAAGAGGCTAAACAATGTGTTGCCCTACTTC
ATATTTTGGATCCTTCTATTTCCATTAGTGAAAAATTAGCTCTTTCTTCG
GATACATTACAAAATATAGTTTCTGGGGACGACGAGCAGCATACAAAACT
CCGCAATTACCTAGATCTTTGGGAAGCCATACAGTCTTATGATATTGATC
GCCAACAGCTCGTTCATCACTTAGTTTATGGTGCAAAAGATCTTTGGAAA
AAAGGAGGAAATGATGAAAAGGCATTGAACCTTCTTCAGCTGGTCTTGAG
GTTTACAAGCTACGATATAGAATGCGAAAGTGTTGTGTTTCTTTTTATAA
AACAGGCGTATAAGCAAGCACTGTCTTCCCATGCCATTGCTCGTCTTTTA
AAGTTAGAAAAATTTATATCGGAAGCGAATATTCCCTCTATAGTGATTAG
TGAGGCTGAGAAGGCCAATTTCTTAGCAGATGCTGAATATCTTTTTGCTC
ATGAAGACTATGACAAATGCTATTTGTATAGCATGTGGTTGACTAAGGTG
GCCCCCTCCCCTCAATCCTATCGCTTAGCAGGGTTATGCCTGATGGAAAA
TAAGCGTTACGACGAAGCTTTAGAATTTCTCTGTATGCTCTCACCCAATG
ATAGTATCAACGACTATAAGACGCAGAAGGCATTAGCATTTTGCCAAAAA
CATCAATCTAAGGACCGAGCTGCCTCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy