Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_2 IGR594 IGR599 IGR592 IGR598 IGR595 IGR597 IGR596 IGR591 IGR593 CPn0745 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 hemB, - CPn0744 recD, - CPn0752 CPn0746 CPn0751 CPn0745 rs20, - CPn0754 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 hemB, - CPn0744 recD, - CPn0752 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 hemB, - CPn0744 rs20, - CPn0754 recD, - CPn0752 CPn0746 CPn0751
* Calculated from Protein Sequence

Gene ID: CPn0750

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tctD  

Definition:
DNA-binding response regulator; possible signal transduction regulatory protein

Gene Start:
846411

Gene Stop:
845704

Gene Length:
708

Molecular Weight*:
26273

pI*:
5.20

Net Charge*:
-7.40

EC:
 

Functional Class:
regulatory functions  

Pathway: pathway table

Comment:
Possible signal transduction regulatory protein.

Blast Summary:  PSI-Blast Search
CPn0750 is orthologous to CT630: residues 1-227 of CPn0750 are 49% similar to residues 1-223 of CT630, a DNA-binding response regulator and possible signal
transduction regulatory protein.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0745
COG name: Response regulators consisting of a CheY-like receiver domain and a HTH DNA-binding domain
Functional Class:  T,K
The phylogenetic pattern of COG0745 is -----QVCEBRHUJ----inX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 142 to 215 (E-value = 3.3e-18) place CPn0750 in the Trans_reg_C family which is described as Transcriptional regulatory protein, C terminal (PF00486)

PDB Hit:


Gene Protein Sequence:
MIGDKIILFVTEDLSLSSQLKDLASQRSDYQILVSPVFPTSFESVAIFCE
YLLLPEQIFSPGIFPEEDLIVLFDTFQEEAITKVLNQGATGYLLRPITAK
VLDAVIRAFLRQHEVLEHSIPDTMTFGDHTFRVLNLVIESPEGSVYLTPS
EAGILKKLLINRGHLCLRKNLLAEIKGNTKEIIARNVDVHIASLRKKLGP
YGSKIVTIRGVGYLFSDDDSIPLQNHDNTAHPNEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCGGTGATAAAATCATATTGTTTGTTACTGAGGATCTCAGTTTATC
TTCGCAATTAAAAGACTTGGCATCACAAAGATCTGATTACCAAATACTCG
TATCTCCGGTGTTTCCGACATCTTTTGAATCTGTTGCTATATTTTGTGAA
TACCTATTGCTACCTGAGCAAATTTTCTCTCCTGGGATCTTTCCAGAAGA
AGATTTAATTGTTCTATTCGATACATTTCAAGAAGAGGCGATCACAAAGG
TGTTAAATCAAGGAGCAACAGGGTATCTTCTCCGTCCTATTACAGCGAAA
GTATTAGATGCCGTGATCAGAGCTTTCCTACGCCAACACGAAGTTCTAGA
GCATAGCATTCCAGATACAATGACTTTTGGAGATCATACATTCCGAGTCT
TGAATCTCGTGATAGAATCTCCAGAAGGAAGCGTATACCTTACCCCTTCT
GAAGCAGGTATTCTTAAAAAACTCCTTATCAACCGTGGACACCTATGTCT
CCGAAAGAATCTTTTAGCAGAGATTAAAGGAAATACTAAAGAAATCATTG
CTCGCAACGTGGATGTCCATATTGCTTCTTTAAGAAAAAAATTAGGTCCC
TACGGATCTAAAATTGTAACGATTCGTGGTGTAGGCTATCTATTTTCAGA
TGATGACAGTATTCCTCTCCAGAATCATGACAATACAGCGCATCCAAACG
AAGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy