Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_2 IGR594 IGR590 IGR592 IGR598 IGR595 IGR597 IGR596 IGR591 IGR593 CPn0745 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 hemB, - CPn0744 nqrA, - CPn0743 recD, - CPn0752 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 hemB, - CPn0744 nqrA, - CPn0743 recD, - CPn0752 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 CPn0753 ispA, - CPn0748 hemB, - CPn0744 nqrA, - CPn0743 recD, - CPn0752 CPn0746 CPn0751
* Calculated from Protein Sequence

Gene ID: CPn0749

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glmU  

Definition:
UDP-N-acetylglucosamine pyrophosphorylase

Gene Start:
845629

Gene Stop:
845003

Gene Length:
627

Molecular Weight*:
22730

pI*:
7.80

Net Charge*:
3.16

EC:
2.7.7.23  

Functional Class:
cell envelope; peptidoglycan  
central intermediary metabolism; amino sugars  

Pathway: pathway table
Nucleotide Metabolism; Aminosugars metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0749 is orthologously related to CT629: residues 4-208 of CPn0749 are 64% similar to residues 3-204 of CT629, a predicted UDP-N-acetylglucosamine pyrophosphorylase from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0110
COG name: Acetyltransferases (the isoleucine patch superfamily)
Functional Class:  R
The phylogenetic pattern of COG0110 is -Mt-y-vCEBR-------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MTYLASSIFSPEDFLYPEIISKAHYTWDILDLMDQMLENHVFSGIHGTVE
SGVTLKNIEKIEIAEDAYVESGAYIVGPCILGSQTEVRHGAYLRGNVITG
SRCVVGHCTEIKNSYLGHHTKAAHFAYLGDSVLSSEVNLGAGVRCANFRL
DGRNIYVRSTSDKSKKIDTGRRKLGAFLGKGVAIGCNVVINPGQHILPHT
RIRPGQVI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTTATCTAGCCTCGTCTATATTTTCTCCTGAGGACTTTCTCTATCC
TGAGATAATCTCCAAAGCTCACTATACCTGGGATATTCTTGATTTAATGG
ATCAGATGCTGGAAAACCACGTGTTTTCTGGGATTCATGGTACTGTAGAG
TCTGGTGTAACTTTAAAAAATATAGAAAAGATTGAGATTGCTGAAGATGC
CTACGTAGAGTCTGGGGCTTACATTGTAGGACCATGCATTCTTGGCTCAC
AAACAGAAGTTCGTCATGGGGCCTATCTGCGAGGCAATGTCATCACAGGC
AGTCGCTGTGTTGTGGGTCACTGTACTGAAATCAAGAATAGCTATTTAGG
TCATCATACGAAAGCCGCTCACTTTGCTTACCTCGGAGATTCTGTGTTAA
GTTCAGAAGTCAATCTAGGTGCTGGAGTACGTTGTGCTAATTTCCGTCTA
GATGGAAGGAACATCTATGTTCGTTCTACCTCAGATAAATCAAAAAAAAT
CGATACAGGGCGTCGTAAACTTGGTGCCTTTTTAGGAAAAGGGGTTGCTA
TAGGATGCAATGTTGTCATCAATCCAGGCCAACATATTCTCCCTCATACT
AGAATTCGTCCTGGTCAAGTCATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy