Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_2 IGR594 IGR590 IGR592 IGR595 IGR597 IGR596 IGR591 IGR593 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 nqrA, - CPn0743 recD, - CPn0752 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 nqrA, - CPn0743 recD, - CPn0752 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 nqrA, - CPn0743 recD, - CPn0752 CPn0746 CPn0751
* Calculated from Protein Sequence

Gene ID: CPn0748

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ispA  

Definition:
geranylgeranyl pyrophosphate synthase

Gene Start:
844987

Gene Stop:
844118

Gene Length:
870

Molecular Weight*:
31463

pI*:
4.90

Net Charge*:
-10.59

EC:
2.5.1.0  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table

Comment:
Prokaryotic GGPP synthetase is involved in the biosynthesis of carotenoids
(gene crtE).

Blast Summary:  PSI-Blast Search
CPn0748 is orthologous to CT628, a predicted geranylgeranyl pyrophosphate synthase:
residues 8-286 are 51% similar to CT628. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0142
COG name: Geranylgeranyl pyrophosphate synthase
Functional Class:  H
The phylogenetic pattern of COG0142 is AmtkYQVCEBRHUJ--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 30 to 283 (E-value = 3.2e-23) place CPn0748 in the polyprenyl_synt family which is described as Polyprenyl synthetase (PF00348)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
179  
289

PDB Hit:


Gene Protein Sequence:
VLHALDTYRPSIESAIEKALEGFGPIGHPIRSPVEYALQGGGKRLRPGLV
CMMAQGLGLNHDVMDSALAVEFVHTSTLIADDLPCMDNDDERRGRPTVHK
AFDEATALLASYALIPAAYSHLRLNAKKLKEQGCDPREIDIAYNIIGDIT
DKNIGCSGVLGGQYDDMFFSNRGQEHVQSIMIKKTGSLFEIACISGWLFG
GGDPQFAPIITSFSNNFGLLFQIKDDFSDLQKDSQQIGLNYALLFGEKAA
LELLARSQNNCLELLDRLSAGGLKNSSEFETIISSLGSF$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTACATGCTTTAGATACGTATCGACCTTCTATAGAAAGTGCTATAGA
AAAGGCTTTGGAAGGATTTGGTCCTATAGGTCACCCGATTCGCTCTCCTG
TAGAATACGCTTTACAGGGCGGTGGAAAGCGTTTAAGACCTGGTTTAGTC
TGCATGATGGCTCAAGGTTTGGGCTTAAATCATGACGTTATGGACTCAGC
TTTAGCTGTAGAGTTTGTCCACACTTCCACCCTAATTGCGGACGATCTTC
CTTGCATGGACAACGACGATGAGCGTAGGGGACGCCCGACGGTACATAAA
GCTTTCGATGAAGCAACCGCCTTACTCGCATCTTACGCCCTAATTCCTGC
TGCTTACTCCCACCTTCGCTTAAACGCAAAGAAGTTAAAAGAACAGGGCT
GTGATCCTAGAGAAATAGATATCGCTTACAACATTATCGGAGATATTACA
GACAAAAATATTGGATGTTCTGGGGTATTAGGAGGGCAGTATGATGATAT
GTTCTTTTCTAACCGAGGTCAAGAACACGTACAATCTATTATGATCAAAA
AAACGGGTTCTCTATTTGAGATTGCATGTATTTCTGGTTGGTTATTTGGT
GGCGGAGACCCACAATTTGCACCTATAATTACAAGTTTCTCAAATAATTT
TGGCTTACTTTTTCAAATAAAAGATGATTTTTCAGATTTACAAAAAGACT
CCCAACAAATTGGGCTAAATTATGCTTTACTATTTGGAGAAAAGGCCGCT
CTAGAGCTATTAGCAAGATCTCAAAACAATTGCTTAGAGCTCTTGGATCG
TCTCAGTGCTGGTGGATTAAAGAATAGTTCTGAATTCGAAACGATTATCT
CGAGTTTAGGATCTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy