Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_2 IGR594 IGR590 IGR589 IGR592 IGR595 IGR588 IGR596 IGR591 IGR593 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0751
* Calculated from Protein Sequence

Gene ID: CPn0746

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
841975

Gene Stop:
843570

Gene Length:
1596

Molecular Weight*:
61137

pI*:
6.10

Net Charge*:
-8.47

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0746 is orthologously related to CT632: residues 1-531 are 71% similar to residues 1-531 of CT632, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1351
COG name: Uncharacterized ACR, THY1 family
Functional Class:  S
The phylogenetic pattern of COG1351 is ---k-qvc--r-uj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MLGKEEEFTCKQKQCLSHFVTNLTSDVFALKNLPEVVKGALFSKYSRSVL
GLRALLLKEFLSNEEDGDVCDEAYDFETDVQKAADFYQRVLDNFGDDSVG
ELGGAHLAMENVSILAAKVLEDARIGGSPLEKSTRYVYFDQKVRGEYLYY
RDPILMTSAFKDMFLGTCDFLFDTYSALIPQVRAYFEKLYPKDSKTPASA
YATSLRAKVLDCIRGLLPAATLTNLGFFGNGRFWQNLIHKLQGHNLAELR
RLGDESLTELMKVIPSFVSRAEPHHHHHQAMMQYRRALKEQLKGLAEQAT
FSEEMSSSPSVQLVYGDPDGIYKVAAGFLFPYSNRSLTDLIDYCKKMPHE
DLVQILESSVSARENRRHKSPRGLECVEFGFDILADFGAYRDLQRHRTLT
QERQLLSTHHGYNFPVELLDTPMEKSYREAMERANETYNEIVQEFPEEAQ
YMVPMAYNIRWFFHVNARALQWICELRSQPQGHQNYRTIATGLVREVVKF
NPMYELFFKFVDYSDIDLGRLNQEMRKEPTT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGGGCAAAGAAGAAGAGTTTACGTGTAAACAAAAGCAGTGTTTGTC
ACATTTTGTTACCAATCTGACGTCCGATGTATTTGCTTTAAAAAATCTTC
CAGAAGTCGTTAAGGGAGCTTTATTTTCTAAATACTCCCGTTCAGTTTTA
GGTTTGCGAGCACTTTTGTTAAAAGAATTTCTATCTAATGAAGAGGATGG
AGATGTTTGTGACGAAGCCTATGACTTCGAAACCGATGTACAGAAAGCTG
CGGACTTTTACCAAAGGGTTCTTGATAATTTTGGGGATGATTCTGTAGGA
GAGCTTGGCGGAGCCCACCTGGCTATGGAAAATGTCTCTATTTTGGCTGC
TAAAGTTTTAGAGGATGCTCGAATTGGCGGATCCCCGCTAGAAAAGTCCA
CAAGATACGTCTATTTCGATCAAAAGGTACGGGGGGAGTATTTATATTAC
CGAGACCCTATTTTGATGACTTCGGCCTTTAAAGACATGTTTTTGGGTAC
TTGTGATTTTTTATTCGATACCTATTCTGCTTTAATCCCTCAAGTTCGTG
CCTATTTTGAAAAACTGTATCCTAAAGATTCTAAAACACCCGCATCTGCC
TATGCCACATCATTACGAGCTAAAGTTTTAGATTGTATACGGGGACTTCT
TCCTGCGGCAACTTTGACAAATCTAGGATTTTTCGGTAACGGTAGGTTTT
GGCAAAATCTGATTCACAAGTTACAAGGTCATAACCTTGCAGAGTTGCGA
CGTTTAGGAGATGAATCCCTAACAGAGCTTATGAAAGTTATTCCTTCATT
TGTAAGTAGAGCCGAGCCTCATCATCACCATCATCAAGCTATGATGCAAT
ATCGAAGAGCTTTAAAAGAGCAGCTCAAGGGACTTGCTGAACAAGCAACA
TTTAGTGAGGAGATGTCTTCTTCACCGAGTGTTCAGTTGGTATACGGAGA
CCCTGATGGCATTTATAAAGTAGCTGCTGGATTTCTTTTTCCTTATTCAA
ATCGTTCTCTTACAGATCTCATAGACTATTGTAAAAAAATGCCTCATGAA
GATCTTGTACAGATTTTAGAGAGCAGTGTTTCTGCAAGAGAAAACCGCCG
GCATAAGTCTCCTCGTGGTTTAGAATGCGTAGAATTTGGCTTTGATATAC
TTGCTGATTTCGGTGCATACCGCGATTTGCAACGACATCGGACGCTGACT
CAAGAACGACAGTTACTCTCTACACATCATGGATACAATTTTCCTGTGGA
GCTTCTAGATACTCCTATGGAAAAATCTTATCGAGAAGCTATGGAGAGGG
CGAATGAAACCTATAATGAGATTGTTCAGGAGTTCCCTGAGGAAGCTCAG
TATATGGTTCCCATGGCTTACAATATACGTTGGTTTTTCCATGTAAATGC
TCGGGCTTTGCAATGGATTTGTGAGTTACGCTCACAGCCTCAAGGTCATC
AAAATTACCGCACTATAGCTACAGGTTTAGTGCGAGAGGTTGTCAAGTTC
AATCCTATGTACGAATTATTTTTCAAATTTGTAGATTATTCTGACATAGA
TTTAGGACGGTTAAATCAGGAAATGCGAAAAGAACCAACGACCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy