Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_2 IGR594 IGR590 IGR589 IGR592 IGR595 IGR588 IGR596 IGR591 IGR593 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0751 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0751
* Calculated from Protein Sequence

Gene ID: CPn0745

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
841903

Gene Stop:
841739

Gene Length:
165

Molecular Weight*:
6166

pI*:
8.70

Net Charge*:
2.36

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
VDSCFDDWRASSLQGSTTYNVAYDPKHTLAYGFCNQVSVKKFHLKPPKSQ
EKFL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGATTCCTGCTTCGACGATTGGCGCGCCTCATCCCTACAGGGGAGTAC
GACGTATAACGTCGCTTATGACCCCAAGCATACTTTAGCTTATGGTTTTT
GTAACCAAGTATCGGTGAAAAAATTTCACCTCAAACCTCCGAAATCACAA
GAGAAATTTTTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy