Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_2 tRNA_Pro_2 IGR594 IGR590 IGR589 IGR592 IGR595 IGR588 IGR587 IGR591 IGR593 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0745 glmU, - CPn0749 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0745 tctD, - CPn0750 ispA, - CPn0748 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 glmU, - CPn0749 CPn0742 nqrA, - CPn0743 CPn0746
* Calculated from Protein Sequence

Gene ID: CPn0744

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemB  

Definition:
porphobilinogen synthase (delta-aminolevulinic acid dehydratase)

Gene Start:
841384

Gene Stop:
840386

Gene Length:
999

Molecular Weight*:
37267

pI*:
6.20

Net Charge*:
-4.82

EC:
4.2.1.24  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; heme, porphyrin and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Comment:
Responsible for the second step in heme biosynthesis, formation of
porphobilinogen. Typically a homomer of eight subunits.

Blast Summary:  PSI-Blast Search
CPn0744 is similar to CT633, a predicted delta-Aminolevulinic acid dehydratase.
Residues 1-326 are 63% similar to CT633. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0113
COG name: Delta-aminolevulinic acid dehydratase
Functional Class: H
The phylogenetic pattern of COG0113 is amt-yq-cebr-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 326 (E-value = 5.6e-155) place CPn0744 in the ALAD family which is described as Delta-aminolevulinic acid dehydratase (PF00490)

PDB Hit:


Gene Protein Sequence:
MSSLTLSRRPRRNRKTAAIRDLLAETHLSPKDLIAPFFVKYGNNIKEEIP
SLPGVFRWSLDLLLKEIERLCTYGLRAVMLFPIIPDDLKDAYGSYSSNPK
NILCHSIHEIKNAFPHLCLISDIALDPYTTHGHDGIFLNGEVLNDESVRI
FGNIATLHAEMGADIVAPSDMMDGRIGYIRSKLDQSGYSKTSIMSYSVKY
ASCLYSPFRDALSSHVTSGDKKQYQMNPKNVLEALLESSLDEEEGADILM
VKPAGLYLDVIYRIRQNTCLPLAAYQVSGEYAMILSAFQQGWLDKETLFH
ESLIAIKRAGADMIISYSAPFILELLHQGFEF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTCTTTAACACTAAGTAGACGTCCTAGAAGAAACCGAAAGACAGC
AGCTATAAGAGATTTGTTGGCCGAAACTCACTTAAGCCCAAAAGATCTCA
TAGCACCATTCTTTGTGAAGTATGGAAATAACATAAAGGAAGAGATCCCG
AGTCTTCCTGGAGTGTTCCGATGGAGTTTGGATTTGCTATTAAAGGAAAT
AGAGCGTTTGTGTACCTACGGGTTACGAGCTGTAATGCTGTTTCCCATTA
TTCCTGATGATCTTAAAGATGCTTACGGTTCTTACTCCTCAAATCCTAAA
AACATCTTATGTCATAGCATTCATGAAATAAAAAACGCATTTCCTCACCT
ATGTCTGATTAGTGATATAGCTTTAGATCCTTATACGACACACGGTCATG
ATGGGATTTTCCTTAATGGAGAGGTCCTTAATGATGAAAGTGTTAGAATT
TTTGGAAATATTGCAACTTTACATGCTGAAATGGGAGCGGATATCGTAGC
TCCGAGTGATATGATGGATGGAAGGATTGGCTACATTCGCTCTAAGTTAG
ACCAGTCTGGCTACTCAAAGACCTCTATAATGTCTTATAGTGTAAAGTAC
GCTTCTTGTTTGTATTCTCCTTTTCGTGATGCGCTGAGTTCTCACGTAAC
TTCAGGAGATAAAAAACAGTATCAGATGAACCCTAAAAACGTATTAGAGG
CATTGCTTGAATCTTCTTTAGACGAGGAGGAGGGAGCAGATATCTTAATG
GTGAAGCCTGCAGGACTCTATCTTGATGTGATCTATCGGATTCGACAAAA
TACCTGTTTGCCTCTAGCTGCGTATCAGGTCAGTGGGGAATACGCTATGA
TCTTATCAGCCTTTCAACAAGGTTGGTTAGATAAAGAAACACTATTTCAT
GAGTCTTTGATAGCAATCAAGAGAGCTGGCGCAGATATGATTATTAGTTA
CTCCGCTCCTTTTATTTTGGAATTACTGCATCAGGGATTTGAATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy