Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_2 tRNA_Pro_2 IGR590 IGR589 IGR592 IGR588 IGR587 IGR591 IGR593 CPn0745 ispA, - CPn0748 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0745 ispA, - CPn0748 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 CPn0745 ispA, - CPn0748 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0739 CPn0739 CPn0742 nqrA, - CPn0743 CPn0746
* Calculated from Protein Sequence

Gene ID: CPn0743

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqrA  

Definition:
Na+-translocating NADH-ubiquinone oxidoreductase subunit alpha

Gene Start:
838962

Gene Stop:
840365

Gene Length:
1404

Molecular Weight*:
52255

pI*:
9.30

Net Charge*:
8.25

EC:
 

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and OtherSubstances; Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to
M. genitalium, T. pallidum and U. urealyticum.

CPn0743 is orthologously related to CT634:
residues 1-459 are 66% similar to residues 1-460 of CT634.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 459 (E-value = 1.6e-282) place CPn0743 in the NQRA family which is described as Na(+)-translocating NADH-quinone reductase subunit A (NQRA) (PF05896)

PDB Hit:


Gene Protein Sequence:
MKITVNRGLDLSLQGSPKESGFYNKIDPEFVSIDLRPFQPLSLKLKVEQG
DAVCSGAPIAEYKHFPNTYITSHVSGVVTAIRRGNKRSLLDVIIKKTPGP
TSTEYTYDLQTLSRSDLSEIFKENGLFALIKQRPFDIPAIPTQTPRDVFI
NLADNRPFTPSPEKHLALFSSREEGFYVFVVGVRAIAKLFGLRPHIVFRD
RLTLPTQELKTIAHLHTVSGPFPSGSPSIHIHSVAPITNEKEVVFTLSFQ
DVLTIGHLFLKGRILHEQVTALAGTALKSSLRRYVITTKGASFSSLINLN
DISDNDTLISGDPLTGRLCKKEEEPFLGFRDHSISVLHNPTKRELFSFLR
IGFNKPTFTKTYLSGFFKKKRTYTNPDTNLHGETRPIIDTDIYDKVMPMR
IPVVPLIKAVITKNFDLANELGFLEVCGEDFALPTLIDPSKTEMLTIVKE
SLIEYAKESGILTPHQD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTACAGTCAATCGGGGTTTAGATTTATCCTTACAAGGGTCTCC
CAAAGAATCTGGTTTCTATAACAAAATCGATCCAGAATTCGTATCTATAG
ACTTAAGGCCATTCCAACCTTTATCTCTTAAACTTAAGGTAGAGCAAGGA
GATGCGGTCTGTTCAGGAGCTCCTATAGCAGAATACAAGCACTTTCCTAA
CACCTACATTACCTCTCACGTTTCAGGAGTAGTTACCGCTATACGACGTG
GAAATAAACGTTCTCTTTTAGATGTCATCATTAAGAAAACTCCTGGTCCT
ACATCTACAGAATATACGTATGATCTCCAAACTCTCTCACGTTCAGATCT
TTCCGAAATCTTTAAGGAAAATGGGCTCTTTGCATTAATCAAACAACGTC
CTTTTGATATTCCCGCAATTCCAACACAAACTCCGAGAGATGTTTTCATC
AATTTAGCTGACAATCGTCCTTTTACTCCAAGCCCAGAAAAACATCTGGC
TCTCTTTTCCTCTAGAGAAGAAGGATTTTATGTATTTGTGGTAGGAGTTC
GAGCTATAGCTAAACTTTTTGGACTCCGTCCTCATATAGTTTTCAGAGAT
CGTTTAACTCTACCTACGCAAGAACTAAAGACAATTGCTCACCTTCATAC
CGTTTCGGGACCATTCCCCTCTGGATCTCCATCGATACATATTCACAGCG
TAGCCCCTATTACCAATGAGAAAGAAGTGGTATTCACACTGTCATTTCAA
GATGTCCTTACTATTGGCCATCTTTTCTTAAAGGGAAGAATTCTGCACGA
GCAAGTCACAGCACTTGCTGGTACTGCACTAAAAAGTTCTCTAAGACGCT
ATGTGATTACTACAAAAGGAGCTAGCTTCTCTAGTTTAATCAATCTTAAT
GACATCTCGGATAACGATACATTAATTAGCGGAGATCCCTTAACAGGAAG
GCTATGCAAAAAGGAAGAGGAACCCTTTTTAGGATTTCGAGACCATTCAA
TTTCAGTCTTACACAACCCAACAAAACGGGAGTTGTTTAGCTTTTTAAGA
ATTGGGTTTAACAAACCGACATTTACAAAAACCTATCTCTCAGGATTTTT
CAAGAAAAAGCGTACCTATACGAATCCAGATACTAACCTCCACGGAGAAA
CTCGGCCGATTATTGATACTGACATCTATGATAAAGTTATGCCGATGAGA
ATTCCTGTAGTTCCTCTGATTAAAGCTGTAATTACTAAAAATTTTGATTT
AGCTAATGAACTAGGGTTTTTAGAGGTTTGTGGTGAAGATTTCGCCTTAC
CCACTCTTATAGATCCATCTAAAACAGAAATGCTTACCATAGTCAAGGAA
TCCTTAATAGAGTACGCCAAGGAATCAGGGATCCTAACTCCCCATCAAGA
TTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy