Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_2 IGR590 IGR589 IGR592 IGR588 IGR587 IGR591 IGR593 CPn0745 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 recB, - CPn0738 CPn0745 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 CPn0746 recB, - CPn0738 CPn0745 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0739 CPn0739 CPn0742 nqrA, - CPn0743 CPn0746 recB, - CPn0738
* Calculated from Protein Sequence

Gene ID: CPn0742

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
838463

Gene Stop:
838891

Gene Length:
429

Molecular Weight*:
16461

pI*:
5.50

Net Charge*:
-1.80

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0742 is orthologously related to CT635: residues 1-142 of CPn0742 are 71% similar to residues 1-144 of CT635, a predicted Chlamydia-specific
hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
37  
71

PDB Hit:


Gene Protein Sequence:
MNSKSAQKIIDSIKQILTIYNIDFDPSFGSSLSSDSDADYEYLITKTQEK
IQELDKRAQEILTQTGMSKEQMEVFANNPDNFSPEEWLALEKVRSSCDEY
RKETENLINEITLDLHPTKESKRPKQKLSSTKKNKKKNWIPL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAGTAAATCTGCGCAAAAAATAATAGATTCTATAAAACAAATCCT
AACTATTTATAATATAGACTTCGATCCCTCCTTTGGATCCTCGTTATCTT
CAGATTCTGATGCAGATTACGAATATCTAATCACAAAAACTCAAGAAAAA
ATCCAAGAGCTAGACAAAAGAGCTCAAGAGATTCTAACACAGACAGGAAT
GTCCAAAGAACAGATGGAAGTCTTTGCAAATAATCCAGATAACTTCTCTC
CAGAAGAGTGGCTGGCCTTAGAAAAAGTCCGTTCTTCTTGCGATGAGTAT
CGAAAAGAGACAGAAAATTTAATCAACGAAATTACCCTAGATTTACATCC
CACAAAAGAATCAAAACGCCCAAAACAAAAATTGTCATCTACCAAAAAAA
ATAAGAAAAAAAACTGGATTCCTCTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy