Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_2 IGR590 IGR589 IGR588 IGR587 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 recB, - CPn0738 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 recB, - CPn0738 hemB, - CPn0744 tyrB, - CPn0740 greA, - CPn0741 CPn0739 CPn0739 CPn0742 nqrA, - CPn0743 recB, - CPn0738 recC, - CPn0737 recC, - CPn0737
* Calculated from Protein Sequence

Gene ID: CPn0740

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tyrB  

Definition:
aromatic amino acid aminotransferase

Gene Start:
836048

Gene Stop:
834861

Gene Length:
1188

Molecular Weight*:
44925

pI*:
6.60

Net Charge*:
-2.98

EC:
2.6.1.57  

Functional Class:
amino acid biosynthesis; aromatic amino acid family  

Pathway: pathway table
Alkaloid biosynthesis I
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Tyrosine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to aromatic AA aminotransferases, e.g. residues 1-394
are 57% similar to the enzyme from C.trachomatis (CT637).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1448
COG name: Aspartate/aromatic aminotransferase
Functional Class:  E
The phylogenetic pattern of COG1448 is ----Y---E--h------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 82 to 393 (E-value = 3.3e-46) place CPn0740 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
302  
329

PDB Hit:


Gene Protein Sequence:
MSFFNHIPTFSPDAILGLQNVFFADKRPEKVNLVIGVYEHPQKRYGGLSC
IRKAQTVILEEEQNKSYLPISGLQIFLDEMRELVFGAVDPSAIVGFQSLG
GTGALHLGARLLSVAKGSGKVYVPEQTWSNHIRIFSQEGLEVIRYPYYSK
EQKQLLFEPLIAFLKEVEKNSVILLHGCCHNPTGVDFTEDMWKELAILMK
ERELIPFFDTAYQGFAHGIELDRKPIEIFISEGNTVLVAASSSKNFALYG
ERVGYFAVHSTFTDELVKIHSFLEEKIRGEYSSPQRWGVEIVSTILSNPY
LKEEWQSELNFIRESLGKMRTRFVQALRKVAGHTFDFLLSQHGFFAYPGF
SDKQVLFLREQHAVYTTAGGRMNLNGITEKNIDHVVQSFIQAYEL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTTTTTTAATCACATACCAACATTTTCTCCGGATGCTATTTTAGG
TTTGCAGAACGTTTTCTTTGCAGATAAGCGTCCCGAAAAGGTTAACCTTG
TGATTGGTGTTTATGAGCATCCGCAAAAGCGTTACGGCGGCTTGTCTTGT
ATACGTAAGGCACAAACTGTCATTTTGGAAGAAGAACAAAATAAGAGTTA
TCTTCCTATTTCAGGGTTGCAAATATTTTTAGATGAGATGCGTGAGCTGG
TTTTTGGTGCTGTAGATCCGAGTGCTATAGTCGGGTTTCAGTCTTTAGGA
GGTACAGGAGCGCTACACTTGGGAGCCCGGCTTCTTTCCGTGGCAAAAGG
ATCTGGTAAGGTTTATGTTCCCGAGCAGACTTGGAGCAATCATATACGCA
TTTTCTCTCAAGAGGGTCTTGAGGTAATCCGATATCCTTATTATAGCAAA
GAACAAAAACAGCTGTTATTTGAACCCCTGATCGCATTTTTGAAGGAAGT
AGAAAAGAATTCCGTTATCTTATTGCATGGTTGTTGTCACAACCCTACAG
GTGTAGATTTTACTGAAGATATGTGGAAAGAACTCGCCATCTTAATGAAA
GAAAGAGAGTTAATTCCATTTTTTGATACCGCATACCAAGGTTTTGCTCA
CGGCATAGAGTTGGATAGAAAACCTATAGAAATTTTTATATCAGAGGGAA
ATACGGTTCTTGTCGCTGCTTCATCAAGCAAAAACTTTGCTCTTTATGGT
GAGCGTGTAGGATATTTTGCTGTTCACAGTACTTTTACTGATGAGTTGGT
TAAAATTCACAGTTTCTTAGAAGAAAAAATTCGAGGGGAATACTCTTCAC
CACAACGTTGGGGTGTAGAAATTGTTTCTACAATTTTGAGTAATCCATAT
TTGAAAGAAGAATGGCAATCAGAACTCAATTTTATAAGAGAGTCTTTGGG
TAAAATGAGAACAAGATTTGTTCAAGCTTTGCGTAAGGTTGCCGGTCATA
CATTTGACTTTTTATTGTCCCAACATGGATTCTTTGCATACCCTGGGTTT
TCCGATAAACAGGTGCTCTTTTTAAGAGAACAACACGCTGTTTATACAAC
AGCGGGAGGAAGAATGAATTTAAATGGAATTACGGAAAAAAATATAGATC
ATGTAGTGCAAAGTTTTATTCAAGCTTATGAGCTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy