Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_2 IGR589 IGR588 IGR587 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 recB, - CPn0738 tyrB, - CPn0740 greA, - CPn0741 CPn0742 nqrA, - CPn0743 recB, - CPn0738 tyrB, - CPn0740 greA, - CPn0741 CPn0739 CPn0739 nqrA, - CPn0743 recB, - CPn0738 recC, - CPn0737 recC, - CPn0737 CPn0742
* Calculated from Protein Sequence

Gene ID: CPn0739

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
834871

Gene Stop:
833858

Gene Length:
1014

Molecular Weight*:
38046

pI*:
7.60

Net Charge*:
2.00

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0739 is orthologously related to CT638: residues 7-250 of CPn0739 are 42% similar to residues 8-250 of CT638, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1792
COG name: Rod shape-determining protein MreC
Functional Class:  M
The phylogenetic pattern of COG1792 is -----q--eb-huj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 107 to 322 (E-value = 4.5e-71) place CPn0739 in the MreC family which is described as rod shape-determining protein MreC (PF04085)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
59  
86
non-globular  
185  
337

PDB Hit:


Gene Protein Sequence:
MSYSLRNKKTKICVYIIIALGILSFRSIPQEVYDKIRSSFVSLHVKFFPK
IKQAPSSHLANLELENLVLKERVASLEEKLKLYEVSNHTPPLFPEILTPY
FHKLVEGKVVYRDYTHWSSSCWVNVGKTHGIKKNSPVLSGNVLVGLVDYV
GEHQSRIRLITDVGMKPSVVAMRGDIQSWWIKHSLRELIRQVEQISHAYI
LEKDKYEKISQLQELDSLIQGEGENQALLRGILSGVGGALWKEGSLCLEG
EGFYFSEGKTLLPGDILVTTGLDGVFPPGLLVARVTKVKAPRDGACTFKI
EAQSLEEKLMELDQLFILPPLEFNPNDRPDIFGLLWD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTATAGCCTACGCAATAAAAAAACAAAAATCTGCGTCTATATTAT
TATTGCTTTAGGGATTCTCTCTTTTCGAAGCATCCCTCAAGAGGTCTATG
ATAAGATCAGAAGCAGTTTTGTCTCTCTACACGTCAAATTTTTCCCTAAA
ATTAAACAAGCTCCTTCTTCTCATCTTGCTAATTTAGAATTAGAGAACCT
CGTTCTTAAGGAGAGGGTGGCTTCTTTAGAAGAGAAACTCAAACTTTATG
AGGTCTCTAATCACACTCCTCCTTTATTTCCAGAGATCTTAACTCCCTAT
TTTCATAAGTTGGTAGAGGGAAAGGTTGTCTATCGAGATTACACACATTG
GTCTAGTTCTTGTTGGGTGAATGTAGGAAAAACTCATGGAATCAAGAAAA
ATTCTCCGGTGCTTTCTGGAAATGTTCTAGTAGGACTTGTCGATTATGTT
GGAGAACACCAATCCCGTATACGATTAATCACAGATGTAGGAATGAAGCC
CTCTGTAGTTGCTATGCGCGGTGATATTCAGTCTTGGTGGATAAAACACA
GTCTTAGAGAACTAATCAGACAAGTAGAGCAGATTTCACACGCCTATATC
CTTGAAAAGGATAAGTATGAAAAAATCTCTCAGCTACAAGAGTTAGATTC
TTTAATACAGGGAGAAGGAGAAAACCAAGCTCTCCTAAGAGGAATACTTT
CTGGAGTGGGTGGGGCTTTATGGAAAGAAGGGTCTTTATGTTTAGAGGGA
GAAGGATTCTACTTTAGCGAGGGAAAAACTCTGCTACCTGGAGATATCTT
AGTGACAACAGGATTAGATGGGGTATTTCCCCCAGGACTGTTGGTGGCTA
GAGTCACCAAGGTAAAAGCTCCTCGTGATGGAGCCTGTACTTTCAAGATA
GAAGCTCAGTCTTTGGAAGAAAAGCTTATGGAGCTGGATCAGCTCTTTAT
TTTACCTCCCCTAGAATTTAATCCTAATGATAGGCCTGACATTTTTGGAT
TGCTTTGGGATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy