Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_2 IGR587 tyrB, - CPn0740 CPn0736 greA, - CPn0741 recB, - CPn0738 tyrB, - CPn0740 CPn0736 greA, - CPn0741 recB, - CPn0738 tyrB, - CPn0740 CPn0736 greA, - CPn0741 CPn0739 CPn0739 recB, - CPn0738 recC, - CPn0737 recC, - CPn0737
* Calculated from Protein Sequence

Gene ID: CPn0738

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recB  

Definition:
exodeoxyribonuclease V beta chain

Gene Start:
830746

Gene Stop:
833898

Gene Length:
3153

Molecular Weight*:
121036

pI*:
6.70

Net Charge*:
-6.14

EC:
3.1.11.5  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
In HAEIN and ECOLI, this enzyme manifests a
range of exonucleolytic and endonucleolytic
activities. It consists of three subunits; see
CPn0737 and CPn0123 for the gamma and alpha
subunits.

Blast Summary:  PSI-Blast Search
CPn0738 is weaky similar to MG244 in M. genitalium, TP0102 in T. pallidum and UU501 in U. urealyticum. They are all predicted DNA helicases.

CPn0738 is orthologously related to CT639, a predicted exodeoxyribonuclease V beta chain: residues 4-1026 are 44% similar to CT639. CPn0738 is also weakly similar to CT608, a predicted ATP dependent DNA helicase. Residues 322-741 are 25% similar to CT608.



COGS Summary:  COGS Search
BeTs to 6 clades of COG1074
COG name: ATP-dependent exoDNAse (exonuclease V), beta subunit, - helicase and exonuclease domains
Functional Class:  L
The phylogenetic pattern of COG1074 is --------ebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0738 shows weak similarity (23%) to CPn0772, a predicted DNA helicase.

Pfam Summary:  Pfam Search
Residues 2 to 651 (E-value = 1.3e-160) place CPn0738 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
761  
952

PDB Hit:


Gene Protein Sequence:
VKPFNIFDSNSSIQGKFFLEASAGTGKTFTIEQIVLRALIEGSLTHVEHA
LAITFTNASTNELKVRIKDNLAQTLRELKAVLNSQPASLPTYLDINCNVK
QIYMQVRNALATLDQMSLFTIHGFCNFVLEQYFPKTRLIHKNPALTHSQL
VLHHITNYLKQDLWKNVLFQEQFHLLAVRYNITSKHTSSLVDKLLASYTQ
PISSYFSSRVERLEQISLWHQQIYNSLLEIPKQVFLDQLTAHISGFKKQP
FSILDDLHHFVDLLYTSETHSSLFSFFKIAETFNFKHRLARYKPCAAFTV
LENMSWVERTLEFCNLDRIFNTLLVDLQEYLKQNYTPWLSPDESVFALEK
LLSSSEAQPVVQALREQYQLVLIDEFQDTDKQQWSIFSNLFISPKFTGSL
FLIGDPKQSIYEWRSADLPTYLTAKSSFSEDKQLQLVNNYRSTPKLMEAI
NQIFGKISPFLEIPGYLPIEYHALNPQSSETFENPPHAPIHFFFYETIKD
QALWIFSEALRLQKEQKIPLGNMVVLVSDSNQAFELISYATIPVSFSKNK
SIFHLTETHILTTALLEAILHPENYEKISKILFSSLFGLSLDEVTTKKED
FTIYFQSLHSYISHHGLLATFYRVMTTQGNVLFSSPRGDLIFQEMEKLCG
YLDTISSYPYHQLLHLKNFSETGRWEEELAISSYSEDLETLKITTIHSSK
GLEYDIVFCPGIEKSKKNKSSSELLREMYVACTRAKKQLYLPISTQPPSL
QRSSALTNYVKLEGTQSSAYDLAIHLHQEHPDLFSYSLPKDHGHATTVLN
LPLLETFALKVTPPKTIFSFSSTKFLLDTHKDSQSIPYSKLPISKQQLPL
GEKTGILIHKILESIQFSLLQDTEYLMSTIMRFIKHTHLEGFEETILKLL
SKTFFSPLTFSSQTFSLSQVLPNKIFRETSFLFLENQELWQGVIDLFFEH
EGKYYIIDWKTSFLGETNSDYSKSNLSIYIKQEKLDYQGRIYVKAVRKFL
NQFEIDDDVELGVIFIRGIDTQGNGFFALNSSEDIPNFNPKAIQKCQAYH
$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGCCGTTTAATATTTTTGACTCAAACTCTTCGATTCAGGGAAAATT
TTTCCTAGAAGCCTCTGCAGGCACAGGAAAAACATTTACTATAGAACAGA
TCGTGTTGCGAGCCTTGATTGAAGGCTCGCTAACACATGTAGAACATGCC
TTAGCAATTACATTTACGAATGCTTCTACCAATGAGCTTAAGGTTCGCAT
CAAAGACAATCTTGCTCAAACTTTAAGAGAATTAAAAGCGGTTCTAAACT
CTCAGCCGGCTTCTTTACCCACATATTTAGATATCAATTGCAATGTAAAG
CAGATTTACATGCAAGTTCGCAATGCTCTTGCTACTCTAGATCAGATGTC
TTTGTTTACGATTCATGGCTTTTGCAACTTTGTTCTAGAACAATATTTTC
CTAAGACCCGTCTTATTCACAAAAACCCTGCTCTGACCCACTCTCAATTA
GTTCTTCATCACATCACTAACTATTTAAAACAAGACCTCTGGAAAAATGT
ACTTTTTCAAGAACAGTTTCATCTATTAGCAGTTCGCTACAATATAACCT
CGAAGCATACATCTTCTCTGGTGGATAAGCTACTTGCCAGCTATACCCAA
CCAATCTCCTCCTACTTTTCCTCACGTGTTGAAAGACTTGAGCAAATTTC
TCTTTGGCATCAACAAATATACAACTCTCTTTTAGAAATTCCAAAACAGG
TTTTTCTAGATCAGCTAACTGCCCACATCTCAGGATTTAAAAAGCAGCCC
TTTTCCATTCTTGATGATCTCCATCATTTTGTGGATCTCCTTTACACTTC
GGAGACCCATAGCTCTTTATTTTCATTCTTTAAAATTGCAGAAACATTCA
ACTTCAAACACCGTCTTGCACGTTACAAGCCTTGTGCTGCCTTTACTGTT
TTAGAAAACATGTCTTGGGTAGAGCGTACTTTAGAGTTTTGTAACTTGGA
TCGAATCTTCAATACTTTGTTAGTCGATCTCCAAGAGTATCTTAAACAAA
ATTATACCCCTTGGCTCTCTCCCGATGAAAGCGTCTTTGCCCTCGAGAAA
CTACTCTCTTCATCTGAAGCTCAACCTGTAGTTCAAGCTCTTAGAGAGCA
ATACCAGCTCGTATTAATTGATGAATTTCAAGATACAGACAAGCAACAAT
GGAGCATCTTTTCGAATCTCTTTATTTCTCCGAAATTTACAGGATCGTTA
TTTCTTATCGGAGACCCCAAGCAATCTATTTATGAATGGAGAAGTGCGGA
TCTTCCTACCTATCTTACAGCCAAATCTTCGTTTTCAGAAGACAAGCAAC
TACAGCTTGTCAATAATTACCGCTCTACACCCAAACTCATGGAAGCCATC
AACCAAATATTCGGGAAAATCTCTCCATTTTTAGAGATCCCTGGCTACCT
ACCTATAGAATACCATGCGCTAAATCCTCAGAGTAGTGAGACATTTGAAA
ATCCCCCCCACGCTCCTATTCATTTCTTCTTTTATGAAACTATTAAAGAC
CAGGCATTATGGATATTCTCAGAAGCGCTAAGACTACAAAAAGAACAAAA
GATTCCCCTAGGGAATATGGTTGTCCTGGTCTCAGACTCAAATCAAGCTT
TTGAGTTAATTTCCTATGCGACTATTCCTGTTTCCTTTTCTAAAAACAAA
TCTATATTTCATCTTACAGAAACTCACATACTGACTACAGCTCTACTAGA
AGCCATTCTTCACCCGGAGAATTATGAAAAAATCAGCAAGATATTGTTCT
CATCTCTTTTTGGACTTTCTTTAGACGAAGTCACAACAAAAAAAGAAGAC
TTTACGATTTATTTCCAATCACTACATAGCTACATCTCACATCATGGACT
TCTGGCTACATTTTACCGAGTGATGACTACGCAAGGAAACGTATTGTTCT
CATCTCCTAGAGGGGATCTTATTTTTCAGGAAATGGAGAAACTTTGTGGT
TACCTAGATACAATTTCTTCTTATCCCTACCACCAACTTCTTCACCTGAA
AAACTTTTCTGAAACAGGACGGTGGGAAGAAGAACTCGCTATATCTTCTT
ATTCTGAGGACTTGGAAACTTTAAAAATCACTACCATTCACTCTTCTAAA
GGTCTCGAATACGATATAGTCTTTTGTCCAGGAATTGAGAAAAGTAAAAA
AAATAAAAGCTCTTCAGAATTACTAAGAGAAATGTACGTTGCTTGCACGA
GAGCAAAAAAACAGCTGTACCTACCTATAAGCACGCAACCGCCTTCTCTT
CAGAGAAGCTCCGCATTAACAAATTACGTGAAATTAGAAGGTACGCAGAG
TTCGGCTTATGACTTAGCTATCCACCTACATCAAGAACATCCTGATTTAT
TTTCGTATTCGCTACCTAAGGACCATGGACATGCTACCACAGTGTTGAAT
CTGCCACTTTTAGAGACGTTCGCTCTAAAAGTGACACCCCCGAAAACTAT
TTTTTCCTTCTCATCTACAAAATTCCTATTGGACACTCACAAAGACTCGC
AATCGATCCCATATTCCAAACTCCCGATTTCAAAACAACAGCTTCCTCTG
GGAGAAAAAACAGGAATTCTTATACACAAAATTTTAGAATCTATTCAATT
TTCTCTATTACAAGACACTGAGTACTTGATGTCTACGATCATGCGTTTCA
TAAAACACACTCATCTTGAAGGATTCGAGGAAACGATTCTTAAACTACTT
AGTAAGACGTTTTTTTCTCCTTTAACATTTTCATCGCAGACATTTTCTCT
ATCTCAAGTTCTACCGAATAAGATATTTCGAGAGACTTCTTTTTTATTTT
TAGAGAACCAAGAGCTGTGGCAAGGGGTGATTGATCTTTTTTTTGAGCAT
GAAGGAAAGTACTACATTATTGACTGGAAAACATCGTTTTTAGGAGAGAC
AAACTCCGATTACTCAAAAAGCAACCTATCTATCTACATAAAACAAGAAA
AATTAGATTACCAAGGCAGGATCTACGTCAAAGCTGTCAGGAAGTTTTTA
AATCAATTTGAAATTGATGATGATGTAGAGCTTGGAGTTATCTTTATCCG
TGGCATAGACACCCAAGGAAATGGGTTTTTCGCTTTAAATAGCAGCGAAG
ACATTCCTAACTTCAATCCCAAAGCAATCCAAAAATGTCAGGCCTATCAT
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy