Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR585 IGR586 udk, - CPn0735 CPn0739 CPn0736 CPn0734 recB, - CPn0738 udk, - CPn0735 CPn0739 CPn0736 CPn0734 recB, - CPn0738 udk, - CPn0735 CPn0739 CPn0736 CPn0734 recB, - CPn0738 recC, - CPn0737 recC, - CPn0737
* Calculated from Protein Sequence

Gene ID: CPn0737

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recC  

Definition:
exodeoxyribonuclease V gamma chain

Gene Start:
827685

Gene Stop:
830759

Gene Length:
3075

Molecular Weight*:
117803

pI*:
6.50

Net Charge*:
-12.87

EC:
3.1.11.5  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum sequences.

CP0737 is orthologously related to CT640, a predicted exodeoxyribonuclease V gamma chain. They share 41% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
387  
442
non-globular  
509  
608

PDB Hit:


Gene Protein Sequence:
MNATKHCRASFSNSPRHLLAQLAEDITSTHQKPFTKRWILVANATTGHWI
KNQLVHVLSDHIFMGSTIFTASDSIVKHLFLGSGCSQPNIPDYLTLPLLI
NNILEEISKASKFENGREFLSPPTYETTKKLAAAFKQFHTFSQRPTKNAS
HYQELFQILESHFSSYEEMFTTILNNRTQEEDCSLHIFGYAHLPKHLAEF
FINLSTYFPVYFYCFSPCREYFGDLLSDRAIDFFWNQLPDSPIKNAWEHY
VLSDRQALLANLAHKSQSSQNFFLDREIDYQEMFLPSKHDSSLGVIQNSI
LDLKPTSPQDFSQTKQTICIYRALNIPREVQEVFCKVTELLHRGVSPEEI
FILSSHIESYKVHLNAIFNPHVPIYFTDEVDPRAEDLRNKILLLSSILQT
QGDLHYILQLLTHPQLQQPIDQNKVPYLIKKLSSEWGKISSKDRASGQQM
KALGDLILEEYPFHQEGGRVSQVEVWETTVPLIYFIQERINLYLSSSQHS
YEDLFQNVFSCLEKIFVLSPEETSFITTLRNSLFPTFATSSCSLLFFTDF
CLDFLLHFHKPSPLYDKPGPYIGSLSSLSLIPKGYVFILGANKTTSSDIF
DLLNRTTTHEELAFSSTEDEENFHFLQILVSTKHELHISYISSAAQFNLP
SPFLNHIKETLDLPVETLPTQPYLSAFFKNKACLHTSQEYNYSLAHAFYS
KKALLPSLFIPTVKQVNLPQHLSLNEIIKGIFSPLDLFLKTNYNLRISYP
EHLKKQQKLFPTKHQIEDFWNECFVDKEHDLIPSISPHAEELFTYYREKT
ILLRNGLDKDPKHSPYTVTFSSSIFEERPYHESYLFPPLSLSFQGNPVQI
HGTIHGVCNEGLYLCSIDPRDSLKKTTRTLGSLPETSSEQKQLLERYVAL
AVLQMSQHLSSDSALIKLTSFNTKENHHPPFSDPEGYLRKVLEVYHLMSS
QPIPLLSPLCWKTLDDEEKFHQAVLSAISEEAKNPSLPIFWQFHNRNIEE
ILNHVGASERLKILSLFRGPCEAV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGCCACCAAACATTGTCGAGCAAGCTTCAGTAACTCGCCCCGTCA
CCTCCTAGCTCAGCTTGCGGAGGATATTACGTCCACACATCAAAAACCTT
TTACCAAAAGGTGGATTCTTGTTGCAAATGCTACTACAGGGCACTGGATA
AAAAACCAACTTGTACATGTCTTGTCAGACCACATCTTTATGGGATCAAC
TATTTTCACTGCTTCGGATTCCATTGTCAAACACTTATTCTTGGGTTCGG
GTTGCTCGCAGCCCAATATTCCGGACTACCTTACCCTTCCCTTGTTAATA
AATAATATTTTAGAAGAAATCTCGAAGGCTTCCAAATTTGAAAATGGAAG
GGAGTTTTTATCTCCACCCACATACGAAACAACAAAAAAACTTGCTGCTG
CGTTTAAGCAGTTCCATACGTTTTCACAACGCCCGACCAAAAACGCCTCC
CATTACCAAGAATTATTTCAAATCTTGGAAAGCCATTTTTCTTCTTATGA
AGAGATGTTCACCACTATTTTAAATAATCGAACGCAAGAGGAGGACTGCT
CCCTTCATATTTTTGGTTATGCTCATCTTCCCAAACATCTTGCGGAATTT
TTTATTAATTTAAGTACGTATTTCCCTGTATATTTCTATTGTTTTTCTCC
CTGTCGAGAATATTTTGGTGATTTACTTTCCGATAGAGCTATTGATTTCT
TTTGGAATCAACTTCCCGACTCCCCAATAAAAAATGCCTGGGAACACTAT
GTATTATCAGACAGGCAAGCACTTCTTGCAAACTTAGCTCATAAATCTCA
GTCGTCGCAAAATTTTTTCCTAGATAGGGAAATAGACTATCAAGAGATGT
TTCTCCCTTCAAAACACGATAGTTCTTTAGGGGTAATACAGAACTCTATT
TTAGACCTCAAGCCCACGTCTCCTCAAGATTTCTCTCAAACAAAGCAGAC
CATTTGTATTTATAGAGCTCTAAATATTCCCAGAGAAGTCCAGGAGGTAT
TTTGTAAAGTTACAGAACTTCTGCATCGCGGAGTGTCACCTGAGGAGATT
TTTATTCTCTCTTCTCACATAGAGAGCTACAAGGTACATCTAAACGCTAT
TTTCAATCCTCATGTGCCTATATACTTTACTGATGAAGTAGATCCACGGG
CTGAAGATCTCAGAAATAAAATCCTCCTACTTTCTTCTATTTTACAAACA
CAAGGGGATTTACATTACATTCTTCAACTCCTTACGCACCCACAACTACA
ACAACCTATAGATCAAAACAAGGTTCCCTATCTGATTAAAAAGCTTTCCT
CAGAATGGGGAAAAATTTCTTCAAAAGACCGAGCTTCGGGTCAACAAATG
AAAGCTCTAGGTGATCTGATATTAGAAGAATACCCATTCCATCAAGAGGG
TGGGCGTGTGAGCCAAGTAGAAGTTTGGGAAACAACAGTACCTTTAATTT
ATTTCATTCAAGAGCGTATCAACCTTTATCTTTCCAGCTCCCAACATAGC
TATGAAGATCTATTTCAAAACGTGTTTTCTTGTTTAGAAAAGATTTTTGT
TTTATCTCCCGAAGAGACCTCTTTCATTACAACGTTAAGGAACTCTCTTT
TCCCAACCTTTGCTACATCTTCCTGTTCTCTTCTTTTTTTCACTGATTTC
TGTTTAGACTTTTTGCTTCATTTCCATAAACCCAGTCCCCTGTATGACAA
GCCAGGACCTTACATAGGTAGTTTGAGTAGCCTCAGCTTAATTCCTAAAG
GCTATGTCTTTATTTTAGGAGCTAATAAAACAACATCGTCTGACATTTTT
GATCTTTTAAATAGGACAACAACACATGAAGAGCTTGCATTTTCTTCTAC
AGAAGACGAGGAAAATTTCCACTTCCTACAAATTTTAGTCTCTACAAAAC
ATGAACTTCATATTAGTTATATATCATCGGCAGCGCAATTCAACCTTCCT
AGTCCCTTTCTAAACCATATTAAAGAAACCTTAGACCTGCCTGTAGAAAC
GTTACCTACACAACCCTACCTCTCTGCTTTCTTCAAGAATAAAGCTTGTT
TACACACCTCTCAAGAATACAACTACTCTCTTGCTCATGCTTTCTATTCT
AAAAAAGCTCTCCTCCCTTCCTTGTTTATTCCAACTGTAAAGCAGGTAAA
TCTTCCTCAACATCTCTCTCTCAATGAAATTATCAAAGGAATCTTTTCTC
CTTTAGACCTCTTTTTAAAAACCAATTACAATCTCAGAATTTCCTACCCA
GAACACCTTAAAAAACAACAGAAACTCTTTCCAACAAAACATCAAATCGA
AGACTTTTGGAATGAATGTTTTGTAGACAAAGAGCATGACCTGATCCCTA
GTATCTCTCCTCATGCTGAAGAGCTTTTTACTTACTATAGGGAAAAGACA
ATCCTATTGCGTAATGGATTGGACAAAGATCCGAAACATTCACCTTATAC
AGTCACATTCTCTTCCTCAATTTTCGAAGAGAGACCCTATCATGAAAGTT
ACCTTTTCCCGCCTCTTTCTTTATCTTTCCAAGGAAATCCGGTCCAAATC
CATGGAACAATTCATGGGGTATGCAATGAGGGACTTTATTTATGTTCTAT
AGATCCTAGAGATTCCCTAAAAAAAACAACCAGAACCCTAGGGAGTCTCC
CAGAAACCTCTTCTGAACAAAAACAGCTCTTAGAAAGATATGTAGCGTTG
GCGGTGTTACAAATGTCTCAGCACCTCTCTTCAGATTCGGCTTTAATAAA
GCTTACATCGTTCAATACTAAAGAAAACCACCATCCTCCTTTTTCGGATC
CTGAAGGTTATCTCCGTAAAGTTTTAGAAGTCTATCACCTGATGTCTTCG
CAACCCATTCCCCTACTTTCTCCATTATGTTGGAAAACCTTAGACGATGA
AGAAAAATTTCATCAGGCAGTACTTTCTGCTATAAGTGAAGAAGCTAAAA
ATCCTTCTCTTCCTATTTTCTGGCAGTTTCACAATCGTAATATCGAGGAG
ATCTTAAATCACGTGGGTGCATCCGAACGTTTGAAAATTTTATCTCTTTT
CAGAGGTCCCTGTGAAGCCGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy