Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR585 IGR583 IGR584 IGR586 IGR582 rs4, - CPn0733 udk, - CPn0735 CPn0736 end4, - CPn0732 CPn0734 recB, - CPn0738 rs4, - CPn0733 udk, - CPn0735 CPn0736 end4, - CPn0732 CPn0734 recB, - CPn0738 rs4, - CPn0733 udk, - CPn0735 CPn0736 end4, - CPn0732 CPn0734 recB, - CPn0738 recC, - CPn0737 recC, - CPn0737
* Calculated from Protein Sequence

Gene ID: CPn0736

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (basic)(possible integral membrane protein)

Gene Start:
827686

Gene Stop:
825989

Gene Length:
1698

Molecular Weight*:
63248

pI*:
10.40

Net Charge*:
27.41

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Few significant hits in gapped BLAST: CPn0736 is similar to CT641, a predicted conserved hypothetical protein. Residues 1-549 are 61% similar to CT641. Residues 22-405 are 23% similar to (AJ235272) 2-ACYLGLYCEROPHOSPHOETHANOLAMINE ACYLTRANSFERASE (aas) [Rickettsia prowazekii]; and residues 18-376 are 19% similar to (AE001788) permease, putative [Thermotoga maritima].
No significant similarities to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0477
COG name: Permeases
Functional Class:  G,E,R
The phylogenetic pattern of COG0477 is AMTKYQVCEBRHUJGPo-INX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 11-163 are 30% similar to a defined domain of YGED_ECOLI, defined as: PROTEIN INTERGENIC REGION TRANSMEMBRANE MUTH-AAS ROCC-PTA.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
98
non-globular  
224  
375

PDB Hit:


Gene Protein Sequence:
MTVSVKKKSFRALVTTHFLTIINDNLYKFLLAFFLLEGKTLTENAKILSC
VSFFFALPFLLLAPLAGSLADRFQKRNIILATRFIEILCTILGTYFFFIQ
SVVGGYVVLILMACHTTIFGPAKLGILPEMLPSEQLSQANGIMTAATYTG
SILGSCLAPLLVDVTHRLGVNSYVWPTLMCVIVSIISTLISFCIRPSNVK
NVKQKITLVSFKDLWKVLKDTRMIHYLTVSIFLGSFFLLIGAYTQLEIIP
FVEFTLKYPKHYGAYLFPIVALGVGTGSYITGKISGKDIKIGYVPLAAIG
LALVFMGLYAFACSILFVLFFLLALGFLGGVYQVPLHAYVQYASPEHKRG
QILAANNFLDFFGVLVAAGVIRVLGSNLGLSPETSFFYIGWFVLAVSIWT
LWIWREHVYRLLLGIILRRQLGYYLKIHQSSSPKCYFVAVQSYREIRRVL
AALTKTVRSRVIILDQKLVPGWRAWLLSWCVPTVVSSVRDNDSEAQDAWA
VLQANHLKTSLKKFPDVSVVCLGLPKNVERFTSILQEQGIDLHPIQLVQK
EGKKRVIYTLVFPHA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGTTTCGGTTAAAAAAAAATCGTTTAGGGCACTAGTAACTACACA
TTTCCTGACGATTATAAACGATAATTTATATAAATTTCTTTTAGCGTTTT
TCCTATTGGAAGGCAAAACTCTAACAGAGAATGCAAAGATTCTCTCCTGT
GTAAGTTTCTTTTTTGCCCTTCCCTTTCTTTTACTAGCTCCGCTAGCTGG
AAGTTTAGCAGATCGCTTTCAGAAACGGAATATTATCTTAGCAACCAGAT
TTATAGAGATTTTATGTACAATTCTCGGAACGTACTTTTTCTTTATCCAA
TCTGTAGTTGGGGGGTATGTAGTCTTAATTTTAATGGCATGTCACACCAC
AATCTTTGGGCCAGCAAAGCTCGGGATTCTTCCCGAAATGCTACCCTCAG
AACAGCTCTCCCAAGCCAACGGGATTATGACAGCAGCCACCTATACAGGA
AGTATTTTAGGTTCTTGCCTTGCTCCTCTTCTTGTCGATGTAACTCATCG
TTTAGGTGTAAATAGCTATGTCTGGCCTACCTTAATGTGTGTTATTGTTT
CTATTATCAGTACTCTTATTTCCTTCTGTATCCGACCTAGCAATGTGAAA
AATGTGAAACAGAAAATCACCTTGGTGAGTTTCAAAGATTTATGGAAAGT
TTTGAAAGATACCCGGATGATTCATTATTTGACTGTATCGATTTTTTTGG
GATCTTTCTTCTTATTGATAGGTGCTTATACTCAGCTAGAGATCATCCCT
TTTGTAGAATTTACTTTAAAATATCCTAAGCATTATGGCGCTTACTTGTT
TCCTATAGTGGCGTTAGGTGTAGGCACGGGGTCGTACATCACCGGGAAAA
TCTCAGGAAAAGATATCAAAATAGGATACGTCCCTTTGGCCGCTATCGGC
CTAGCTCTCGTATTTATGGGGCTGTATGCCTTTGCTTGTTCGATACTATT
CGTGTTGTTTTTTTTACTCGCACTGGGATTTCTTGGTGGGGTGTATCAAG
TGCCTCTCCATGCTTATGTACAATATGCAAGCCCGGAACATAAGAGAGGG
CAAATTTTGGCTGCCAATAACTTTTTAGATTTCTTTGGAGTGTTAGTCGC
TGCAGGAGTGATCCGAGTTTTGGGAAGTAACTTAGGCTTGTCTCCTGAAA
CAAGTTTTTTCTATATCGGTTGGTTTGTGCTCGCTGTCTCTATCTGGACA
TTATGGATATGGAGAGAACACGTCTATCGCCTGTTGTTGGGTATCATATT
AAGACGGCAGCTAGGTTACTATTTAAAAATCCACCAGTCTTCGAGCCCGA
AATGTTATTTTGTTGCCGTACAAAGTTATAGGGAAATCCGACGTGTTTTA
GCTGCTCTAACCAAAACAGTGAGAAGCAGAGTCATCATTCTCGACCAAAA
ATTAGTGCCAGGATGGAGAGCGTGGTTATTGTCTTGGTGTGTTCCCACAG
TTGTCTCTAGTGTTAGAGATAACGATTCTGAGGCCCAAGATGCCTGGGCT
GTTCTACAAGCAAATCACCTGAAAACATCTTTGAAAAAATTTCCTGATGT
CAGTGTTGTATGTTTGGGACTACCCAAGAATGTAGAGAGATTTACATCCA
TACTACAAGAACAAGGTATCGACTTGCATCCGATACAACTTGTTCAGAAA
GAAGGGAAAAAAAGAGTGATTTATACTCTAGTGTTTCCTCATGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy